DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpina10b

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:433 Identity:104/433 - (24%)
Similarity:194/433 - (44%) Gaps:63/433 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFST---YNA 68
            :||..:....:.:.:..||. ..:.|.:.....||::.|.::|..:: ..|:.|||.|.   ::|
Zfish     5 LLLVFISACFLCSAEHEELR-TPDISDLAFRNTDFAINLYRKISSLH-DRNVVFSPLSVSTCFSA 67

  Fly    69 LLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSP-----------MELS 122
            ||||   :...|..|:.:.|||                :..|....|:.|           :::.
Zfish    68 LLLA---AQGSTRTEILKGLNL----------------EALDGGDSRRVPELFQQLHQNISLQME 113

  Fly   123 SANRIFVDR----TINVSNKFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEE 183
            ....:|:|:    ..|.|.:...........:|| :.|......||::::.||..::.:||  |.
Zfish   114 QGTALFLDQHFHLQTNFSQQIQRFFNAEVLRVDF-SKPAVCRSLINEFVSRKTGRKVLEML--ES 175

  Fly   184 ITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQII 248
            :.|.|.::|.|..:.||.|...|....|....|::::.....|.||.....|.:..|..|:::::
Zfish   176 VEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMMMLEEKFSVVEDRDLRARVL 240

  Fly   249 KLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELS 313
            :||||                ...||:|:||::: .....:...::|:.:..|.:.....|:|:.
Zfish   241 RLPYR----------------GGASMLILLPSAD-ADYTAIEDEISAERLHGWIKNMRRMKMEVH 288

  Fly   314 LPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT 378
            ||:|:.:|...:..:|..:|::::|..:|....|:.| ..|.:....|.|.|:|.|.|::||::|
Zfish   289 LPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRD-AHLKVSQVLHKAVIEVYEQGTSAASST 352

  Fly   379 ILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            .:.::..|.   |..|..|.||.|.:|.|:..::||.|...||
Zfish   353 SVGITAYSL---PDTFIINRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 97/398 (24%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 97/400 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.