DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and Rspry1

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001346022.1 Gene:Rspry1 / 67610 MGIID:1914860 Length:576 Species:Mus musculus


Alignment Length:234 Identity:71/234 - (30%)
Similarity:113/234 - (48%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LADLSVTKQMLIVRTWLDDK---FQQIQTDSNEEIRRLYMETESRIGPDLTIFDVDYTTT----- 104
            :::.|::.:::.:..|.||.   .:|:...:...:..|:::.    |..||...||....     
Mouse   263 ISESSISDRLVTLELWADDPDYLKRQVGFCAQWSLDNLFLKE----GRQLTYEKVDLNNIRAMLN 323

  Fly   105 -------VRVSSDRLALR-SQGSFNTVRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQF--NE 159
                   :::|...|..| ...||.:||...||..|.|.||:.:.|.||||||||:...:|  :|
Mouse   324 SNDVSEYLKISPHGLEARCDASSFESVRCTFCVDTGVWYYEVTVVTSGVMQIGWATRDSKFLNHE 388

  Fly   160 NSGVGDTKSSYGYDGSKQQIWHISTKK--YGDKWQIGDVIGVTIDVDKEVIEYYRNGRSM---GV 219
            ..|:||.:.|..|||.:|.||:.:..|  ....|:.||.:|..:|::::.:.::.||..:   ..
Mouse   389 GYGIGDDEYSCAYDGCRQLIWYNARSKPHVHPCWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQ 453

  Fly   220 AFNKLEKGPGISFFAAISLGYTQGIEANFGNRPFMYPVS 258
            .|:....|    ||||.|....|..|.|||.|||.||.|
Mouse   454 VFSSTVSG----FFAAASFMSYQQCEFNFGARPFKYPPS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 47/133 (35%)
zf-C3HC4_3 1261..1309 CDD:290631
Rspry1NP_001346022.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..99
SPRY_RING 359..479 CDD:293941 43/123 (35%)
RING-HC_RSPRY1 525..565 CDD:319480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5105
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.720

Return to query results.
Submit another query.