DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and hnrnpua

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_694691.5 Gene:hnrnpua / 566326 ZFINID:ZDB-GENE-030131-3731 Length:760 Species:Danio rerio


Alignment Length:336 Identity:69/336 - (20%)
Similarity:122/336 - (36%) Gaps:96/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 METESRIGPDLTIFDVDYTTTV--RVSSDRLALRS-------------QGSFNTVRANCCVYGGR 133
            :|.|.....|.|:....|...:  :||.||.:..|             :||:...:...|     
Zfish   185 LEEEDEEFDDTTVCLDTYNCDLHFKVSRDRYSASSLTMESFAYLWAGGRGSYGVDKGKAC----- 244

  Fly   134 WMYEI---------HLHTKGV----MQIGWA-SNSCQFNENSGVGDTKSSYGYDGSKQQIWHIST 184
              :|:         |:.:||:    :.:||: :||...     :|:...||.:..:.::..:..|
Zfish   245 --FEMKVIEKIPVKHISSKGIEDHDVLVGWSLANSSYL-----LGEEAYSYAFSMTAKKTSNAVT 302

  Fly   185 KKYGDKWQIGDVIGVTIDVDKEVIE--YYRNGRSMGVAFN-KLEKGPGISFFAAISLGYTQGIEA 246
            :.||:.:...||:|..|:.|...:|  :.:||..:|.||. ..::..|...|..: |.:...:|.
Zfish   303 EDYGETFDENDVVGCFINFDGAEVEISFSKNGEDLGKAFTVSKDELKGKPLFPHV-LCHNCAVEF 366

  Fly   247 NFGNR--PFMYPVSGFQPLMARPILKLQRANLLMNYLVNLAGIFSKYNAQSGMAPTNGADARV-- 307
            |||.:  ||.....||..|...|                   :..:.....|  |.|..|..|  
Zfish   367 NFGQQESPFFAQPDGFTLLQQIP-------------------VHDRIRGPKG--PENKKDCEVIV 410

  Fly   308 ------------STKKT-----VYCIFAT------LLIEKFTNEIFDPYIIEDVLLRK---ISSM 346
                        .||.|     .|.|..|      ::|.....::.|...:.::.||.   :...
Zfish   411 VVGLPGSGKTEWVTKHTEANPGKYNILGTDTILEKMMISTLKRQMKDVTKLLEISLRAPLFLGKF 475

  Fly   347 TNLASEKENSY 357
            ..:|:.|:.:|
Zfish   476 IEIAARKKRNY 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 31/143 (22%)
zf-C3HC4_3 1261..1309 CDD:290631
hnrnpuaXP_694691.5 SAP 6..40 CDD:128789
SPRY_hnRNP 197..372 CDD:293942 41/187 (22%)
NK 408..562 CDD:302627 14/79 (18%)
AAA_33 408..552 CDD:290396 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.