DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and rspry1

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001038537.2 Gene:rspry1 / 565154 ZFINID:ZDB-GENE-061026-2 Length:580 Species:Danio rerio


Alignment Length:234 Identity:72/234 - (30%)
Similarity:114/234 - (48%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LADLSVTKQMLIVRTW---LDDKFQQIQTDSNEEIRRLYME----------TESRIGPDLTIFDV 99
            :::..::.::.::.:|   ||...:|:...:...:..|:::          ..|.|...|...||
Zfish   267 VSESCISDRLSVLESWADNLDYLKRQVGFCAQWSLDNLFIKEGRQFTYEKVNLSNINAMLNSNDV 331

  Fly   100 -DYTTTVRVSSDRLALR-SQGSFNTVRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQF--NEN 160
             :|   :::|...|..| ...||.:||...||..|.|.||:.:.|.||||||||:...:|  :|.
Zfish   332 SEY---LKISPTGLEARCDASSFESVRCTFCVDSGVWYYEVTVITSGVMQIGWATKDSKFLNHEG 393

  Fly   161 SGVGDTKSSYGYDGSKQQIWHISTKKYGDK--WQIGDVIGVTIDVDKEVIEYYRNGRSM----GV 219
            .|:||.:.|..|||.:|.||:.:..|....  |:.||.||..:|:.|:.:.:|.||..:    .|
Zfish   394 YGIGDDEYSCAYDGCRQLIWYNARSKPHSHPCWKEGDAIGFLLDLSKKQMIFYLNGHQLPPEKQV 458

  Fly   220 AFNKLEKGPGISFFAAISLGYTQGIEANFGNRPFMYPVS 258
            .|:...     .||||.|....|..|.|||.:||.:|.|
Zfish   459 FFSATS-----GFFAAASFMSYQQCEFNFGAKPFRHPPS 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 50/134 (37%)
zf-C3HC4_3 1261..1309 CDD:290631
rspry1NP_001038537.2 SPRY_RING 363..483 CDD:293941 46/124 (37%)
zf-C3HC4_3 527..572 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.