DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and CG30122

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001163196.1 Gene:CG30122 / 37146 FlyBaseID:FBgn0050122 Length:1272 Species:Drosophila melanogaster


Alignment Length:242 Identity:55/242 - (22%)
Similarity:90/242 - (37%) Gaps:63/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HDNLYSDLDDDLEGANCSTVPDPRPAKLADLSVTKQMLIVRTWLDDKFQQIQTDSNEEIRRLYME 85
            |.....|..:....|...|||:..|       ..::..:..:|||.                  :
  Fly   269 HRGSVGDKRESKAAAEERTVPEDEP-------TIEENKVGLSWLDS------------------D 308

  Fly    86 TESRIGPDLTIFDVDYTTTVRVSSDRLALRSQGSFNTVRANCCVYGGRWMYEIHLHTKGVMQIGW 150
            ...||.|      ..:.:...::|:..:|...|:    |||..|..|:..:|:.|..:.|.:   
  Fly   309 LHLRIDP------TTFASAKPLTSEIYSLIWSGA----RANYGVREGKVCFEVRLSEESVPE--- 360

  Fly   151 ASNSCQFNENSGV----------------GDTKSSYGYDGSKQQIWHISTKKYGDKWQIGDVIGV 199
              ||..|.:...|                |:.:.|:||..:.::........||..:|:.||||.
  Fly   361 --NSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQSEFTDYGKPYQLDDVIGC 423

  Fly   200 TIDVDKE--VIEYYRNGRSMGVAFNKLEKG----PGISFFAAISLGY 240
            .:|::.|  .|.|..||..:|||| :.||.    .|..|...::.||
  Fly   424 YLDLESEPCTINYTLNGEDLGVAF-EFEKSILGEEGALFPHIVTKGY 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 39/141 (28%)
zf-C3HC4_3 1261..1309 CDD:290631
CG30122NP_001163196.1 SAP 6..40 CDD:280251
SPRY_hnRNP 300..480 CDD:293942 48/204 (24%)
PHA02664 <529..659 CDD:177447
AAA_33 709..855 CDD:290396
NK 709..>836 CDD:302627
DUF1777 1033..>1104 CDD:285811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.