DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and Hnrnpul1

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_008757177.1 Gene:Hnrnpul1 / 361522 RGDID:1307456 Length:860 Species:Rattus norvegicus


Alignment Length:419 Identity:91/419 - (21%)
Similarity:166/419 - (39%) Gaps:114/419 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DHDNLYSDLDDDLEGANCSTVPDPRPAKLADLSVTKQMLIVRTWLDDKFQQIQTDSN-------- 76
            :::::|.....|:|       |..:..:..:|....:.....::|..:..|::||..        
  Rat   119 ENESVYDRRPLDME-------PPQQAYRPVELKTETKQEAPPSFLPPEASQLKTDRPQFQNRKRP 176

  Fly    77 -EEIR-RLYME-TESRIG----PDLTIFDVDYTTTV------------RVSSDRLA---LRSQG- 118
             ||.| |.|.| .|.|.|    |.....:.|:..|:            :|:.||.:   |..:| 
  Rat   177 FEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGF 241

  Fly   119 --SFNTVRANCCVYGGRWMYEIHLHTK-------------GVMQIGWASNSCQFNENSGVGDTKS 168
              .::..||:..|..||..:|:.::.:             .|::|||:.:||    ::.:|:...
  Rat   242 AYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSC----STQLGEEPF 302

  Fly   169 SYGYDGSKQQIWHISTKKYGDKWQIGDVIGVTIDV----DKEVIEYYRNGRSMGVAFNKLEKGPG 229
            ||||.|:.::..:...:.||||:...||||...|.    |.| :.:.:||:.||:||...::..|
  Rat   303 SYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVE-LSFTKNGKWMGIAFRIQKEALG 366

  Fly   230 ISFFAAISLGYTQGIEANFGNR--PFMYPVSGFQPLMARPILKLQRANLLMNYLVNLAGIFSKYN 292
            ........|.....:|.|||.|  |:...:.||..:...|:.:..|..:                
  Rat   367 GQALYPHVLVKNCAVEFNFGQRAEPYCSILPGFTFIQHLPLSERIRGTI---------------- 415

  Fly   293 AQSGMAPTNGADARV-------STKKTVYCI--FATLLIEKF----TNEIFDPYIIE-------- 336
                 .|.:.|:..:       :..||.:.|  .|:...:|:    ||.|.|...:.        
  Rat   416 -----GPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNY 475

  Fly   337 ----DVLLRKISSMTN----LASEKENSY 357
                |||:::.:...|    :|:.|:.:|
  Rat   476 AGRWDVLIQQATQCLNRLIQIAARKKRNY 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 39/143 (27%)
zf-C3HC4_3 1261..1309 CDD:290631
Hnrnpul1XP_008757177.1 SAP 3..37 CDD:128789
SPRY_hnRNP 213..390 CDD:293942 47/181 (26%)
AAA_33 425..570 CDD:290396 16/80 (20%)
NK 425..>563 CDD:302627 16/80 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.