DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and HNRNPUL2

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001073027.1 Gene:HNRNPUL2 / 221092 HGNCID:25451 Length:747 Species:Homo sapiens


Alignment Length:402 Identity:86/402 - (21%)
Similarity:157/402 - (39%) Gaps:123/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QTDSNEEIRRLYME---------TESRIGP---------DLTIFDVD-YTTTV--RVSSDRLA-- 113
            |.|..:|..|.|.|         ::|.:.|         |.|:.::| ||:.:  :||.||..  
Human   203 QRDEKDEHGRAYYEFREEAYHSRSKSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSKDRYGGQ 267

  Fly   114 -LRSQGSFNTVRANCCVYGGRWMYEIHLHTKG----------------------VMQIGWASNSC 155
             |.|: .|.|:.:     |.|..|.:   |||                      ::::||   |.
Human   268 PLFSE-KFPTLWS-----GARSTYGV---TKGKVCFEAKVTQNLPMKEGCTEVSLLRVGW---SV 320

  Fly   156 QFNENSGVGDTKSSYGYDGSKQQIWHISTKKYGDKWQIGDVIGVTIDVDKEVIE--YYRNGRSMG 218
            .|:... :|:.:.|||:||...:..:...:::|..:...||||...:.:.|.:|  :.:||..:|
Human   321 DFSRPQ-LGEDEFSYGFDGRGLKAENGQFEEFGQTFGENDVIGCFANFETEEVELSFSKNGEDLG 384

  Fly   219 VAFNKLEKGPGISFFAAISLG----------YTQGIEANFGNR--PFMYPVSGFQPLMARPILK- 270
            |||          :.:..||.          ....:|.|||.:  ||..|...|..:.|.|:.: 
Human   385 VAF----------WISKDSLADRALLPHVLCKNCVVELNFGQKEEPFFPPPEEFVFIHAVPVEER 439

  Fly   271 ---------LQRANLLMNYLVNLAGIFSKYNAQSGMAPTNGADARVSTKKTVYCIFA-TLLIEKF 325
                     ::...:::  :|.|.|        ||........|:.:.:|....:.| |:|.:..
Human   440 VRTAVPPKTIEECEVIL--MVGLPG--------SGKTQWALKYAKENPEKRYNVLGAETVLNQMR 494

  Fly   326 TNEIFDPYI---IEDVLLRK----ISSMTNLASEKENSYSVLHGLLSLFWNYMEGDEIKFVLRKL 383
            ...:.:|.:   ..|:|:::    :|.:..:||..:.::     :|.....|..|...|.:|.| 
Human   495 MKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNF-----ILDQCNVYNSGQRRKLLLFK- 553

  Fly   384 VNALLGTFTHTI 395
                  ||:..:
Human   554 ------TFSRKV 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 34/160 (21%)
zf-C3HC4_3 1261..1309 CDD:290631
HNRNPUL2NP_001073027.1 SAP 3..37 CDD:128789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..242 8/38 (21%)
SPRY_hnRNP 246..417 CDD:293942 46/193 (24%)
NK 454..>636 CDD:302627 24/128 (19%)
AAA_33 454..599 CDD:290396 24/128 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 627..666
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.