DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and F16A11.1

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_492499.1 Gene:F16A11.1 / 172764 WormBaseID:WBGene00008876 Length:673 Species:Caenorhabditis elegans


Alignment Length:163 Identity:57/163 - (34%)
Similarity:80/163 - (49%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DYTTTVRVSSDRLALRSQ-GSFNTVRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQF--NENS 161
            |.:..:::..|.|..|.. .||.:||....|..|.|.||..:.|.||||||.|:...:|  :|..
 Worm   360 DVSEYLKIGPDGLEARCDVSSFESVRCTFEVMDGVWYYEATVLTSGVMQIGLATKRSRFLNHEGY 424

  Fly   162 GVGDTKSSYGYDGSKQQIWH--ISTKKYGDKWQIGDVIGVTIDVDKEVIEYYRNGRSMGVAFNKL 224
            |:||..||..|||.:|.:|:  .|.|...:.||.||||||.:::.:..:.:|.||..:.....:.
 Worm   425 GIGDDASSVAYDGCRQLVWYNAKSHKHEHENWQPGDVIGVLLNIPEGEVVFYLNGTPLKEPETEF 489

  Fly   225 --EKGPGISFFAAISLGYTQGIEANFGNRPFMY 255
              .:.|....|||.|....|....|||...|.|
 Worm   490 LSNRQPSEGVFAAASFMSFQQCRFNFGASRFKY 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 47/132 (36%)
zf-C3HC4_3 1261..1309 CDD:290631
F16A11.1NP_492499.1 SPRY_RING 393..516 CDD:293941 44/122 (36%)
zf-C3HC4_3 561..605 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I5958
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19089
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.