DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and HNRNPUL1

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_005258516.1 Gene:HNRNPUL1 / 11100 HGNCID:17011 Length:866 Species:Homo sapiens


Alignment Length:427 Identity:93/427 - (21%)
Similarity:169/427 - (39%) Gaps:117/427 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKVFNEDIFE----QVDHDNLY-SDLDDDL-EGANCSTVPDPRPAKLADLSVTKQMLIVRTWLDD 66
            :|..||..:|    :::....| .::..:: :||..|.:    |.:.:.|...:|          
Human   116 IKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFL----PPEASQLKPDRQ---------- 166

  Fly    67 KFQQIQTDSNEEIRRLYME-TESRIG----PDLTIFDVDYTTTV------------RVSSDRLA- 113
            :||..:....|...|.|.| .|.|.|    |.....:.|:..|:            :|:.||.: 
Human   167 QFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSG 231

  Fly   114 --LRSQG---SFNTVRANCCVYGGRWMYEIHLHTK-------------GVMQIGWASNSCQFNEN 160
              |..:|   .::..||:..|..||..:|:.::.:             .|::|||:.:||    :
Human   232 YPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSC----S 292

  Fly   161 SGVGDTKSSYGYDGSKQQIWHISTKKYGDKWQIGDVIGVTIDV----DKEVIEYYRNGRSMGVAF 221
            :.:|:...||||.|:.::..:...:.||||:...||||...|.    |.| :.:.:||:.||:||
Human   293 TQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVE-LSFTKNGKWMGIAF 356

  Fly   222 NKLEKGPGISFFAAISLGYTQGIEANFGNR--PFMYPVSGFQPLMARPILKLQRANLLMNYLVNL 284
            ...::..|........|.....:|.|||.|  |:...:.||..:...|:.:..|..         
Human   357 RIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGT--------- 412

  Fly   285 AGIFSKYNAQSGMAPTNGADARV-------STKKTVYCI--FATLLIEKF----TNEIFDPYIIE 336
                        :.|.:.|:..:       :..||.:.|  .|:...:|:    ||.|.|...:.
Human   413 ------------VGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVM 465

  Fly   337 ------------DVLLRKISSMTN----LASEKENSY 357
                        |||:::.:...|    :|:.|:.:|
Human   466 GLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 39/143 (27%)
zf-C3HC4_3 1261..1309 CDD:290631
HNRNPUL1XP_005258516.1 SAP 3..37 CDD:128789
SPRY_hnRNP 211..388 CDD:293942 47/181 (26%)
AAA_33 423..568 CDD:290396 16/80 (20%)
NK 423..>561 CDD:302627 16/80 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.