DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6752 and hnrnpul1l

DIOPT Version :9

Sequence 1:NP_001247116.1 Gene:CG6752 / 41826 FlyBaseID:FBgn0038296 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_003198760.1 Gene:hnrnpul1l / 100330645 ZFINID:ZDB-GENE-030131-890 Length:877 Species:Danio rerio


Alignment Length:329 Identity:74/329 - (22%)
Similarity:139/329 - (42%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ETESRIGPDLTIFDVDYTTTV--RVSSDRLA---LRSQG---SFNTVRANCCVYGGRWMYEIHLH 141
            |.|..|..:|.:.|. |...:  :|:.||.:   |..:|   .:...||...|..||..:|:.::
Zfish   263 EEEEDIDDNLVVIDT-YNCDLHFKVARDRYSGYPLTIEGFAYLWAGARATYGVNKGRVCFEMKIN 326

  Fly   142 TK-------------GVMQIGWASNSCQFNENSGVGDTKSSYGYDGSKQQIWHISTKKYGDKWQI 193
            .:             .|::|||:.:||    ::.:|:...|:||.|:.::..:...:.||:|:..
Zfish   327 EEIPVKHLPSTEPDPHVVRIGWSLDSC----STQLGEEPFSFGYGGTGKKSCNCKFEDYGEKFTE 387

  Fly   194 GDVIGVTIDVD--KEV-IEYYRNGRSMGVAFN-KLEKGPGISFFAAISLGYTQGIEANFGNR--P 252
            .|::|..||.:  :|: |.:.:||:|:|..:. ..|:..|.:.|..: |.....:|.|||.|  |
Zfish   388 SDILGCYIDFESSEEIEIAFSKNGKSLGSCYRVSREELAGRALFPHV-LVKNCAVEFNFGQREEP 451

  Fly   253 FMYPVSGFQPLMARPILKLQRANLLMNYLVNLAGIFSKYNAQSGMAPTNGADARV-------STK 310
            :..|..||                  .||.:::   .:...:..:.|.|..|..:       .:.
Zfish   452 YFPPPEGF------------------TYLQDIS---LEDRVRGSVGPANKTDCEILMMVGLPGSG 495

  Fly   311 KTVYCI-FATLLIEKFTNEIFDPYIIE-----------------DVLLRKISSMTN----LASEK 353
            ||.:.: :|....||..|.:....|:|                 |||:::.:...|    :|:.|
Zfish   496 KTTWALKYAKENPEKKFNILGTNAIMEKMKVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARK 560

  Fly   354 ENSY 357
            :.:|
Zfish   561 KRNY 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6752NP_001247116.1 SPRY_RNF123 122..249 CDD:293940 36/143 (25%)
zf-C3HC4_3 1261..1309 CDD:290631
hnrnpul1lXP_003198760.1 SAP 6..40 CDD:128789
PHA02664 <37..125 CDD:177447
SPRY_hnRNP 273..450 CDD:293942 46/182 (25%)
AAA_33 485..630 CDD:290396 15/80 (19%)
NK 485..>630 CDD:302627 15/80 (19%)
FTZ 752..>821 CDD:281812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.