DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Gyc76C

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster


Alignment Length:671 Identity:192/671 - (28%)
Similarity:281/671 - (41%) Gaps:225/671 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 EPE------KSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDF----SRDLM 350
            ||:      |.|.|||:              .|..|::.|:|...      |..|:    .||..
  Fly   760 EPKEIVDYVKKLPLKGE--------------DPFRPEVESIIEAE------SCPDYVLACIRDCW 804

  Fly   351 LAGTQQSVEL---------------KLALDQEQQKSKK--------LEESMRLLDEEMRRTDELL 392
            ....::..|.               |..:||..:..:|        :.|..|||.||..:|::||
  Fly   805 AEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLL 869

  Fly   393 YQMIPKQVADRLRRGE--NPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDK 455
            ::|:|:.||::|..|:  .|:.    :|.|:|.|||||.||.:.:..||::||:.||.:|::||:
  Fly   870 HRMLPQSVAEKLTMGQGVEPVS----YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDR 930

  Fly   456 LTERNSVYKVETIGDAYMVVAGAPDKDAN-HAERVCDMALDMVDAITDLKDPSTGQH-------- 511
            :.....||||||||||||||:|.|.|:.: ||..:..|||:::.|:.        ||        
  Fly   931 IIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVK--------QHRIAHRPNE 987

  Fly   512 -LRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVL---IGPNYK 572
             |::|:|:|:|.||||:|||.|||||||||||||||||||...|:|:|||...|:.   :|..|.
  Fly   988 TLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYI 1052

  Fly   573 IIERGEIDVKGKGTMGTYWLE-ERENRLPLQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTP 636
            ..:||.:::||||.:.|:||. ..||.:..:|...:.:.|.....|..:||..            
  Fly  1053 TEKRGLVNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPLFSRPRKSPKLN------------ 1105

  Fly   637 MMPVSVSLAASMPTSNVPAVDVMASSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPS 701
                        |.|..|::..|....:.|              ..|:.|..|:.|.|.      
  Fly  1106 ------------PDSRQPSIQAMHFCGTGS--------------RRQSTVPRAMDGEST------ 1138

  Fly   702 VASGATGAAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQPDQERRRESRSN-STGHV 765
                                   ||       .:.||..|| |..::.|::|.|...:. ..||.
  Fly  1139 -----------------------YS-------LQGSVRESP-RMVSKRDRDRERPPINGLGAGHF 1172

  Fly   766 FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPC--------------GFSPTP----- 811
                   :.|:|       ||..|.|.|:|.::..|::.|              |....|     
  Fly  1173 -------VGGAL-------LESAQASLSTLNHSETNETNCDMDGGSGGVSGSGSGLVRQPNALHK 1223

  Fly   812 ------PFRIGSAPPKPRPSNPDKFTPEELAAMDQLTPPSTAPARETASCSSASLD--------- 861
                  |.||.||...|:..:.|..:.:.|             .||     |.|||         
  Fly  1224 PLAMVRPHRIISAAQLPQLGDNDDDSADTL-------------LRE-----SRSLDPMPMQQLRK 1270

  Fly   862 RDKATKL--KKITFSNSSSLD 880
            |....||  .|::.:||.|||
  Fly  1271 RHDRVKLPPSKLSKNNSRSLD 1291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 33/140 (24%)
CYCc 383..571 CDD:214485 94/202 (47%)
Herpes_ICP4_C 794..>955 CDD:332854 28/123 (23%)
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 16/86 (19%)
HNOBA <835..881 CDD:285003 15/45 (33%)
CYCc 860..1052 CDD:214485 94/203 (46%)
Guanylate_cyc 887..1074 CDD:278633 93/198 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.