DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Gucy2g

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:236 Identity:108/236 - (45%)
Similarity:160/236 - (67%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGEN--PIDTCEMFDSVSILFSDIVTFTEICSR 436
            :||..|.|..|.|:.::||..|:|..|.::|..|::  |    |.|:||:|.|||||.||::||.
Mouse   856 VEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEP----EHFESVTIFFSDIVGFTKLCSL 916

  Fly   437 ITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKD-ANHAERVCDMALDMVDAI 500
            .:|::||.:||.:||:||...:.:.|||||||||||||.:|.|.:: |.||:.:..|||.::...
Mouse   917 SSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMALHLLSVT 981

  Fly   501 TDLK-DPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST- 563
            |..: .....:.|::|:|:|:|.||||:||:.||||||||||||.||||||:|:.:::|:|:|| 
Mouse   982 THFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTA 1046

  Fly   564 -KVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLPLQL 603
             .:|....|.:.:||.|.|||||...|:||:.::. .|:.|
Mouse  1047 GALLAAGGYHLQKRGTISVKGKGEQTTFWLKGKDG-FPVPL 1086

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 11/29 (38%)
CYCc 383..571 CDD:214485 90/193 (47%)
Herpes_ICP4_C 794..>955 CDD:332854
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485 90/193 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.