DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Adcy5

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_072122.2 Gene:Adcy5 / 64532 RGDID:71014 Length:1262 Species:Rattus norvegicus


Alignment Length:294 Identity:79/294 - (26%)
Similarity:154/294 - (52%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 WRMIMFLGT-----PVMPDLTSLITTGLYINDL----SMHDFSRDLML----------------A 352
            |..:.|:.|     ||.  :.:.:.:|:.::.|    |:|..::|..|                .
  Rat   331 WWTVFFIYTIYTLLPVR--MRAAVLSGVLLSALHLAISLHTNAQDQFLLKQLVSNVLIFSCTNIV 393

  Fly   353 GTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF 417
            |.......:::..|..|::::..::......|.::.:.||..::|:.||..::...|......||
  Rat   394 GVCTHYPAEVSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMF 458

  Fly   418 --------DSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMV 474
                    |:|||||:||..||.:.|:.|..|:|..||.:::.||||...|...:::.:||.|..
  Rat   459 HKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYC 523

  Fly   475 VAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFG 539
            |:|.|:..|:||....:|.:||::||:.::: .||.::.:|||:|||.|..|::||:..::.::.
  Rat   524 VSGLPEARADHAHCCVEMGMDMIEAISLVRE-VTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWS 587

  Fly   540 DTVNTASRMESTSIAMKVHISESTKVLIGPNYKI 573
            :.|..|:.||:...|.::||:::|...:..:|::
  Rat   588 NDVTLANHMEAGGKAGRIHITKATLNYLNGDYEV 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 20/115 (17%)
CYCc 383..571 CDD:214485 64/195 (33%)
Herpes_ICP4_C 794..>955 CDD:332854
Adcy5NP_072122.2 AC_N 1..459 CDD:318454 22/129 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..196
Guanylate_cyc 461..634 CDD:306677 56/162 (35%)
DUF1053 669..761 CDD:399378
Guanylate_cyc 1063..1257 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.