DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and gucy2ca

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_009297342.1 Gene:gucy2ca / 572052 ZFINID:ZDB-GENE-091118-67 Length:1025 Species:Danio rerio


Alignment Length:260 Identity:119/260 - (45%)
Similarity:151/260 - (58%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 QQKSKKL----EESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIV 428
            |..|:.|    ||...|...|..|.|:|.:.::|..|...|:  |......|::|.|:|.|||||
Zfish   717 QMYSRNLEHLVEERTALYKAERDRADQLNFMLLPGPVVRSLK--ETGRVEPELYDEVTIYFSDIV 779

  Fly   429 TFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDAN-HAERVCDM 492
            .||.||...||||||.|||.:|..||.:.:.:.|||||||||||||.:|.|..:.| ||..:|.|
Zfish   780 GFTTICHHSTPMEVVDMLNDIYKNFDSILDHHDVYKVETIGDAYMVASGLPRCNGNRHAVDICLM 844

  Fly   493 ALDMVDAI-TDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMK 556
            |||:::.: |.......|..|.||:|:|||...||:||.|||||||||||||||||||||.:.::
Zfish   845 ALDILEFMGTFQLRHLPGIPLWIRIGIHSGPCAAGVVGNKMPRYCLFGDTVNTASRMESTGLPLR 909

  Fly   557 VHISEST-KVL--IGPNYKIIERGEIDVKGKGTMGTYWLEERENRLPLQLTAALQVHPLSPVPPT 618
            :|:|||| |:|  ....::...|||..:||||...|||           ||.........|.|||
Zfish   910 IHVSESTIKILQRTDCEFECERRGETFLKGKGKEMTYW-----------LTGVTGQKYSLPTPPT 963

  Fly   619  618
            Zfish   964  963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 12/39 (31%)
CYCc 383..571 CDD:214485 97/192 (51%)
Herpes_ICP4_C 794..>955 CDD:332854
gucy2caXP_009297342.1 Periplasmic_Binding_Protein_Type_1 31..365 CDD:299141
PKc_like 428..698 CDD:304357
Pkinase_Tyr 451..689 CDD:285015
CYCc 736..929 CDD:214485 97/194 (50%)
Guanylate_cyc 763..950 CDD:278633 100/197 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.