DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and npr3

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:320 Identity:71/320 - (22%)
Similarity:121/320 - (37%) Gaps:75/320 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 ITTGLYINDL----SMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDEL 391
            |.|.:|.:::    |..|..||||||..::    ||..|.....:.:|..|....|...||.|: 
Zfish   215 IITSVYGSEVVIMCSKADIVRDLMLAAHRR----KLTSDSHIFFNIELFNSSSYGDGSWRRRDK- 274

  Fly   392 LYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDI------------VTFTEICSRITP-MEVV 443
             |.       |..|...:.::|..:..|....|.|.            :...|.||.:.. ||..
Zfish   275 -YD-------DEARAAYSFLNTVTLLRSTKPEFEDFSIEMKKSLQQSNIPICEDCSAVNMFMEGF 331

  Fly   444 SMLNAMYSIFDK------LTERNSVYKVETIGD-AYMVVAGAPDKDANHAERVCDMALDMVDAIT 501
            .....:|:|..:      ||::|.:....::.: .:..:||....||| .:|..|.      ::.
Zfish   332 HDALLLYAIALREVKSKGLTKKNGLEITHSMWNRTFEGIAGQVSLDAN-GDRNGDF------SVV 389

  Fly   502 DLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVL 566
            .:.||.:|:|..:.....:......:.|.|...:.|  .|:.....::.:|..:.|  |..|.::
Zfish   390 RMTDPESGKHETVMNYFGTNGSFQILPGFKREWFSL--RTIPPPKPLDPSSGGLGV--SAVTGII 450

  Fly   567 IG---------------PNYKI-IE----RGEIDVKGKGTMGTYWLEERENRLPLQLTAA 606
            :|               .||:| ||    |.|.|: ||..      :.||:.:....:||
Zfish   451 VGGILGTALLLAFYFFRKNYRITIERRTLREECDI-GKHR------QLREDSIRSNFSAA 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 22/76 (29%)
CYCc 383..571 CDD:214485 40/222 (18%)
Herpes_ICP4_C 794..>955 CDD:332854
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 48/220 (22%)
ANF_receptor 46..389 CDD:279440 44/193 (23%)
TM_EphA1 436..468 CDD:214014 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.