DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and adcy2a

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_692173.5 Gene:adcy2a / 563724 ZFINID:ZDB-GENE-061109-1 Length:1155 Species:Danio rerio


Alignment Length:240 Identity:77/240 - (32%)
Similarity:132/240 - (55%) Gaps:18/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 LAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQV-----ADRLRRGENP 410
            :||......::|||.|..|.:....:|...|:.|.|:.:.||..::|..:     |:.::|.:.|
Zfish   262 VAGAYHKHLMELALKQTYQDTCNCIKSPIKLEFEKRQQERLLLSLLPAHIARVMKAEIIQRLQGP 326

  Fly   411 ----IDTCEMF--------DSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVY 463
                ::....|        .:||||::|||.||.:.|..:|.|:|.|||.::..||::.:.|...
Zfish   327 KFGQVENTNNFHNLYVQRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECM 391

  Fly   464 KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIV 528
            :::.:||.|..|:|.|:...|||:....|.|||.:||..::| :||..:.:|||||||.|:.|::
Zfish   392 RIKILGDCYYCVSGLPESLPNHAKNCVKMGLDMCEAIKKVRD-ATGVEISMRVGVHSGNVLCGVI 455

  Fly   529 GLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPNYKI 573
            ||:..:|.::...|..|:.||:..:..:|||:..|...:...||:
Zfish   456 GLQKWQYDVWSHDVTLANHMEAGGVPGRVHITSETLEHLNGAYKV 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 15/57 (26%)
CYCc 383..571 CDD:214485 66/204 (32%)
Herpes_ICP4_C 794..>955 CDD:332854
adcy2aXP_692173.5 AC_N <92..319 CDD:292831 15/56 (27%)
CYCc 295..498 CDD:214485 66/203 (33%)
Guanylate_cyc 340..524 CDD:278633 59/162 (36%)
DUF1053 554..658 CDD:283888
CYCc 912..1120 CDD:214485
Guanylate_cyc 942..1141 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.