DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and ADCY10

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_060887.2 Gene:ADCY10 / 55811 HGNCID:21285 Length:1610 Species:Homo sapiens


Alignment Length:183 Identity:46/183 - (25%)
Similarity:80/183 - (43%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 DEEMRRT-DELLYQMIPKQVADRLRRGE----NPIDTCEMFDSVSILFSDIVTFTEICSRITP-- 439
            |.|:..: .:.:.:.|.||:.::..:|.    .|:..  :|  |:::|.|.....||...|..  
Human   258 DPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTI--VF--VNLMFEDQDKAEEIGPAIQDAY 318

  Fly   440 MEVVSML-------NAMYSIFDKLTERNSVYKVETIGDAYMVVAGAP-DKDANHAERVCDMALDM 496
            |.:.|:|       |.:: :|||             |.:::.|.|.| :|..:......:.|:|:
Human   319 MHITSVLKIFQGQINKVF-MFDK-------------GCSFLCVFGFPGEKVPDELTHALECAMDI 369

  Fly   497 VDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKM-PRYCLFGDTVNTASRM 548
            .|..:.:....|     :.:||.||.|..||||..: ..|.:.|..||.|:||
Human   370 FDFCSQVHKIQT-----VSIGVASGIVFCGIVGHTVRHEYTVIGQKVNLAARM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 5/22 (23%)
CYCc 383..571 CDD:214485 45/182 (25%)
Herpes_ICP4_C 794..>955 CDD:332854
ADCY10NP_060887.2 CHD 40..214 CDD:143636
AcyC <42..197 CDD:225025
CHD 292..461 CDD:143636 39/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.