DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and npr1b

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_009290669.2 Gene:npr1b / 555911 ZFINID:ZDB-GENE-100805-4 Length:1070 Species:Danio rerio


Alignment Length:242 Identity:110/242 - (45%)
Similarity:163/242 - (67%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 LDQEQQKSKKLEESMRLLD-------EEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVS 421
            |.:.:|.:..|||   |::       ||.|:.:.||||::|..||::|:|||..  ..|.||||:
Zfish   828 LSRMEQYANNLEE---LVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETV--QAEAFDSVT 887

  Fly   422 ILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDAN-H 485
            |.|||||.||.:.:..||::||::||.:|:.||.:.:...||||||||||||||:|.|.::.. |
Zfish   888 IYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLH 952

  Fly   486 AERVCDMALDMVDAITDLK---DPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASR 547
            ...:..|:|.:::|:...|   .|.  :.|::|:|:|||.|.||:|||||||||||||||||:||
Zfish   953 GREIARMSLALLEAVKTFKIRHRPD--EQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSR 1015

  Fly   548 MESTSIAMKVHISESTKVLIGP--NYKIIERGEIDVKGKGTMGTYWL 592
            |||....:|:|:|.:|:.::..  .:::..||::::||||.|.||||
Zfish  1016 MESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWL 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 16/46 (35%)
CYCc 383..571 CDD:214485 93/193 (48%)
Herpes_ICP4_C 794..>955 CDD:332854
npr1bXP_009290669.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.