DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and NPR2

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:247 Identity:120/247 - (48%)
Similarity:166/247 - (67%) Gaps:11/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 GTQQSVELKLALDQEQQKSKKL-EESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEM 416
            ||.....|.|.::|.....:|| ||..:...||.|:.:.||||::|..||::|:|||..  ..|.
Human   850 GTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETV--QAEA 912

  Fly   417 FDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDK 481
            ||||:|.|||||.||.:.:..|||:||::||.:|:.||.:.:...||||||||||||||:|.|.:
Human   913 FDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGR 977

  Fly   482 DA-NHAERVCDMALDMVDAITDLK---DPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTV 542
            :. .||..:..|||.::||::..:   .|.  ..||:|:|||:|.|.||:|||||||||||||||
Human   978 NGQRHAPEIARMALALLDAVSSFRIRHRPH--DQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTV 1040

  Fly   543 NTASRMESTSIAMKVHISESTKVLIGP--NYKIIERGEIDVKGKGTMGTYWL 592
            ||||||||...|:|:|:|.:||..:..  .:::..||::::||||.|.||||
Human  1041 NTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 19/51 (37%)
CYCc 383..571 CDD:214485 100/193 (52%)
Herpes_ICP4_C 794..>955 CDD:332854
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944
HNOBA <857..902 CDD:311573 17/44 (39%)
CYCc 881..1065 CDD:214485 100/187 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.