DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and CG10738

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:346 Identity:133/346 - (38%)
Similarity:192/346 - (55%) Gaps:45/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 LDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSM 445
            |.||.::||.||::|:|:.|||:|::| :.:|. |.::.|||.|||||.||.:.:..||::||..
  Fly   884 LQEEKKKTDALLHEMLPRCVADQLKKG-HKVDP-EHYEQVSIYFSDIVGFTAMSAECTPLQVVDF 946

  Fly   446 LNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDAN-HAERVCDMALDMVDAITDLK---DP 506
            ||.:|:.||.:.....||||||||||||||:|.|.::.: ||..:..|:|.::.|:::.|   .|
  Fly   947 LNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRP 1011

  Fly   507 STGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIG--P 569
            :  ..|.:|:|:|||.|.||:|||||||||||||||||||||||:.:.:|:|.|...:.|:.  .
  Fly  1012 T--NRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLG 1074

  Fly   570 NYKIIERGEIDVKGKGTMGTYWL--EERENRLPLQLTAALQVHPLSPVPPTPTPKT-KAIMPPVS 631
            .|...|||.|.:||||...||||  |:.|.|                     |.:| :......|
  Fly  1075 GYHFAERGVISMKGKGDQRTYWLLGEDEEAR---------------------TRRTYERSQRRGS 1118

  Fly   632 KPLTPMMPVSVSLA----------ASMPTSNVPAVDVMASSSSISGLALTAAAAAHMSLHHQAVV 686
            :.|...:..::..|          :|:...|:|...:..|||..|...|..||.:.:. ||:...
  Fly  1119 RALNKFIQGTIKQAQEQANEYGIRSSLKQKNLPRNSLTRSSSLESPKKLRFAAGSLLE-HHRYHS 1182

  Fly   687 AEALTGASVEVALPSVASGAT 707
            .|||........|...:.|:|
  Fly  1183 DEALLEVDSYTGLRRSSGGST 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 12/22 (55%)
CYCc 383..571 CDD:214485 93/193 (48%)
Herpes_ICP4_C 794..>955 CDD:332854
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 12/22 (55%)
CYCc 886..1078 CDD:214485 94/195 (48%)
Guanylate_cyc 913..1099 CDD:278633 93/188 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.