DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and CG32301

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster


Alignment Length:434 Identity:100/434 - (23%)
Similarity:181/434 - (41%) Gaps:100/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWF-DLVRP 252
            |.:|.:|..:..|||   ..|.  ||.:|...|.||..:   :.::.|....|...|:| .|...
  Fly   116 LMALLLTAMDLILPI---CYFR--PFSLVPSYDHVVIVL---IYLMFPIAFVKNGRAYFLGLAVS 172

  Fly   253 LIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIM 317
            |..|.:..::::      :.|:|.|.|                     |...|..::..| .:.|
  Fly   173 LFYFGYMALIDK------ISTLDKVWE---------------------LTAYGAYLFFLN-MLCM 209

  Fly   318 FLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLD 382
            ||......::.|.|.:...:                ..|::..::|:.:|:              
  Fly   210 FLSRFQEYNMRSGILSRYQV----------------VYQNLVFQMAMKEEK-------------- 244

  Fly   383 EEMRRTDELLYQMIPKQVADRLRRG------ENPID------TCEMF----DSVSILFSDIVTFT 431
                   .||..:||..:|..|:..      |:|.:      |..:|    ..||||.:|:|.||
  Fly   245 -------ALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFT 302

  Fly   432 EICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDM 496
            .:.:.:...::|::|:.::..||.....|...:::.:||:|..|.|.|.....||....:.||||
  Fly   303 GLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVNQALDM 367

  Fly   497 VDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISE 561
            ::...:: .....:.:.:|:|||||.::|||:||...::.::...|:..:|:||:.:...||||.
  Fly   368 IEISREV-SKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISS 431

  Fly   562 STKVLIGPNYKIIERGEIDVK-----GKGTMGTYWLEERENRLP 600
            .|..|: .|:.:.|.|....|     .:..:.||.:   .:|||
  Fly   432 RTLGLL-DNHYVYEEGTDTAKLDPLLQRSNLSTYLI---RSRLP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 37/203 (18%)
CYCc 383..571 CDD:214485 56/203 (28%)
Herpes_ICP4_C 794..>955 CDD:332854
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 47/157 (30%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453927
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.