DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and GUCY2F

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001513.2 Gene:GUCY2F / 2986 HGNCID:4691 Length:1108 Species:Homo sapiens


Alignment Length:282 Identity:117/282 - (41%)
Similarity:169/282 - (59%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 QQKSKKLEESMRLLDEEM----RRTDELLYQMIPKQVADRLRRGENPIDTC----EMFDSVSILF 424
            :|.|..||:.:|...||:    ::|::||.||:|..||:.|::|      |    |.||.|::.|
Human   829 EQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKG------CTVEPEGFDLVTLYF 887

  Fly   425 SDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKD-ANHAER 488
            ||||.||.|.:...|:|||.:||.:|::||.:...:.|||||||||||||.:|.|.:: :.||..
Human   888 SDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAE 952

  Fly   489 VCDMALDMVDAITDLKDPSTGQHL-----RIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRM 548
            :.:|:||::.::...|    .:|:     |||:|:|||.||||:|||.|||||||||||||||||
Human   953 IANMSLDILSSVGTFK----MRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRM 1013

  Fly   549 ESTSIAMKVHISESTKVL---IGPNYKIIERGEIDVKGKGTMGTYWLEERENRLPLQLTAALQVH 610
            |||.:..::|:|.||..:   :...|::..||..::|||||..|:||..::..:           
Human  1014 ESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFM----------- 1067

  Fly   611 PLSPVPPTPTPKTKAIMPPVSK 632
                 .|.|.|      |||.|
Human  1068 -----KPLPVP------PPVDK 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 15/39 (38%)
CYCc 383..571 CDD:214485 94/204 (46%)
Herpes_ICP4_C 794..>955 CDD:332854
GUCY2FNP_001513.2 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357
HNOBA <824..869 CDD:285003 15/39 (38%)
CYCc 848..1040 CDD:214485 92/201 (46%)
Guanylate_cyc 875..1062 CDD:278633 92/190 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.