DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Npr3

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:141 Identity:32/141 - (22%)
Similarity:54/141 - (38%) Gaps:47/141 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVY-------------PENLLQKLA---KKAQQ 56
            |:..:..|.||:..|     :.| |...|...|.|             ||  .:|.:   |.:.:
  Rat   399 NIELFNSSSYGDGSW-----KRG-DKHDFEAKQAYSSLQTVTLLRTAKPE--FEKFSMEVKSSVE 455

  Fly    57 VLGVSERDFMDQMGVYFVGFVGQYGYDRV-LSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI 120
            ..|::|.|:::   ::..||     :|.: |.||.            |||.|:..|.:......|
  Rat   456 KQGLNEEDYVN---MFVEGF-----HDAILLYVLA------------LHEVLRAGYSKKDGGKII 500

  Fly   121 CE--NETKQGL 129
            .:  |.|.:|:
  Rat   501 QQTWNRTFEGI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572 32/141 (23%)
HNOBA 201..404 CDD:311573
CYCc 383..571 CDD:214485
Herpes_ICP4_C 794..>955 CDD:332854
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 32/141 (23%)
ANF_receptor 182..535 CDD:279440 32/141 (23%)
TM_EphA1 587..618 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.