DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Gucy2g

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_620611.2 Gene:Gucy2g / 245708 RGDID:621853 Length:1103 Species:Rattus norvegicus


Alignment Length:235 Identity:106/235 - (45%)
Similarity:160/235 - (68%) Gaps:11/235 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGEN--PIDTCEMFDSVSILFSDIVTFTEICSR 436
            :||....|..|.|:.::||..|:|..|.::|..|::  |    |.|:||:|.|||||.||::||.
  Rat   859 VEERTCQLVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEP----EHFESVTIFFSDIVGFTKLCSL 919

  Fly   437 ITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKD-ANHAERVCDMALDMVDAI 500
            .:|::||.:||.:||:||...:.:.|||||||||||||.:|.|.:: |.||:.:..|:|.::...
  Rat   920 SSPLQVVKLLNDLYSLFDHTIQTHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMSLHLLSVT 984

  Fly   501 TDLK-DPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST- 563
            |:.: .....:.|::|:|:|:|.||||:||:.||||||||||||.||||||:|:.:::|:|:|| 
  Rat   985 TNFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTA 1049

  Fly   564 -KVLIGPNYKIIERGEIDVKGKGTMGTYWLEEREN-RLPL 601
             .:|:...|.:.:||.|.|||||...|:||..::. .:||
  Rat  1050 RALLVAGGYHLQKRGTISVKGKGEQTTFWLTGKDGFAVPL 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 10/29 (34%)
CYCc 383..571 CDD:214485 89/193 (46%)
Herpes_ICP4_C 794..>955 CDD:332854
Gucy2gNP_620611.2 PBP1_GC_G_like 50..439 CDD:107367
ANF_receptor 66..417 CDD:279440
PK_GC 558..832 CDD:270894
CYCc 868..1058 CDD:214485 89/193 (46%)
Guanylate_cyc 895..1081 CDD:278633 92/189 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.