DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Adcy5

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001012783.3 Gene:Adcy5 / 224129 MGIID:99673 Length:1262 Species:Mus musculus


Alignment Length:294 Identity:80/294 - (27%)
Similarity:154/294 - (52%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 WRMIMFLGT-----PVMPDLTSLITTGLYINDL----SMHDFSRDLML----------------A 352
            |..:.|:.|     ||.  :.:.:.:|:.::.|    |:|..|:|..|                .
Mouse   331 WWTVFFIYTIYTLLPVR--MRAAVLSGVLLSALHLAISLHTNSQDQFLLKQLVSNVLIFSCTNIV 393

  Fly   353 GTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF 417
            |.......:::..|..|::::..::......|.::.:.||..::|:.||..::...|......||
Mouse   394 GVCTHYPAEVSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMF 458

  Fly   418 --------DSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMV 474
                    |:|||||:||..||.:.|:.|..|:|..||.:::.||||...|...:::.:||.|..
Mouse   459 HKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYC 523

  Fly   475 VAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFG 539
            |:|.|:..|:||....:|.:||::||:.::: .||.::.:|||:|||.|..|::||:..::.::.
Mouse   524 VSGLPEARADHAHCCVEMGMDMIEAISLVRE-VTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWS 587

  Fly   540 DTVNTASRMESTSIAMKVHISESTKVLIGPNYKI 573
            :.|..|:.||:...|.::||:::|...:..:|::
Mouse   588 NDVTLANHMEAGGKAGRIHITKATLNYLNGDYEV 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 21/115 (18%)
CYCc 383..571 CDD:214485 64/195 (33%)
Herpes_ICP4_C 794..>955 CDD:332854
Adcy5NP_001012783.3 AC_N 1..459 CDD:292831 23/129 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194
CYCc 425..620 CDD:214485 64/195 (33%)
Guanylate_cyc 461..622 CDD:278633 56/162 (35%)
DUF1053 669..761 CDD:283888
CYCc 1037..1238 CDD:214485
Guanylate_cyc 1063..1257 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.