DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and ADCY4

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:368 Identity:103/368 - (27%)
Similarity:163/368 - (44%) Gaps:73/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 LTSLITTGLYINDLSMHDFSRDLML---------------AGTQQSVELKLALDQEQQKSKKLEE 376
            |:.|:..|||   |.....||..:|               ||......::.||....:::.....
Human   150 LSHLLVLGLY---LGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSLH 211

  Fly   377 SMRLLDEEMRRTDELLYQMIPKQVADRLR----------RGENPIDT-------CEMFDSVSILF 424
            |.|.||.|.:..:.||..::|..:|..::          :|..|..|       .:....||:|:
Human   212 SRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLY 276

  Fly   425 SDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERV 489
            :|||.||.:.|..:|.|:|.|||.::..||::.:.:...:::.:||.|..|:|.|....:||...
Human   277 ADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINC 341

  Fly   490 CDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIA 554
            ..|.|||..||..|: .:||..:.:|||||||:|:.|::||:..:|.::...|..|:.||:..:.
Human   342 VRMGLDMCRAIRKLR-AATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVP 405

  Fly   555 MKVHISESTKVLIG----------------------PNYKIIERGEIDVKGKGTMGTYW--LEER 595
            .:|||:.:|..|:.                      |.|.:|:....:...|||.|...  ||..
Human   406 GRVHITGATLALLAGAYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGL 470

  Fly   596 ENRLPLQLTAALQ-----------VHPLSPV-PPTPTP-KTKA 625
            :.|..|.:|..|:           .|..||| ..||.| ||.|
Human   471 KMRPSLLMTRYLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLA 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 22/91 (24%)
CYCc 383..571 CDD:214485 64/226 (28%)
Herpes_ICP4_C 794..>955 CDD:332854
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831 22/98 (22%)
CYCc 219..422 CDD:214485 63/203 (31%)
Guanylate_cyc 264..418 CDD:278633 54/154 (35%)
DUF1053 479..583 CDD:283888 12/35 (34%)
CYCc 827..1042 CDD:214485
Guanylate_cyc 864..1063 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.