DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and gcy-25

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001294116.1 Gene:gcy-25 / 191653 WormBaseID:WBGene00001549 Length:1034 Species:Caenorhabditis elegans


Alignment Length:262 Identity:94/262 - (35%)
Similarity:149/262 - (56%) Gaps:11/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 INDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKL-EESMRLLDEEMRRTDELLYQMIPKQV 400
            |.|....:|.:|:......|.:|:   :|:.....::: .|..|.|:::|..|:.||||::||.|
 Worm   741 ITDAVNREFGQDVKGTLIDQMIEM---IDEYSANLEQIVAERTRELEQDMSVTENLLYQLLPKSV 802

  Fly   401 ADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV 465
            ||.:|.|:..:.  |...||::|..|:..||:.|....|:.::..|..:||.||.:.::|..:||
 Worm   803 ADSIRSGKTVVP--EQHSSVTLLVVDVCQFTKFCEAFIPVHILETLQELYSSFDNIVQKNKAFKV 865

  Fly   466 ETIGDAYMVVAGAPDKDA-NHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVVAGIV 528
            |.:||||::.:|.|:... .|...:|.::|.:...:...|......| |:|::|:.||||.|||:
 Worm   866 ENVGDAYLICSGIPEMSGFRHLREICKISLKLQAFMKTFKVRHRPSHTLQIKMGITSGAVAAGIL 930

  Fly   529 GLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLI---GPNYKIIERGEIDVKGKGTMGTY 590
            |...||:|:||||||.|.||.||.....:.:||.|...:   .|::.:.|||.|||||||...|:
 Worm   931 GSTAPRFCIFGDTVNMACRMASTGNPGSIQLSELTANTLMEKFPSFMLEERGMIDVKGKGACLTF 995

  Fly   591 WL 592
            ||
 Worm   996 WL 997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 21/67 (31%)
CYCc 383..571 CDD:214485 71/192 (37%)
Herpes_ICP4_C 794..>955 CDD:332854
gcy-25NP_001294116.1 PBP1_iGluR_N_LIVBP_like 56..>230 CDD:107346
PKc_like 473..746 CDD:304357 2/4 (50%)
SPS1 474..>736 CDD:223589
HNOBA <764..805 CDD:285003 14/43 (33%)
CYCc 790..976 CDD:214485 70/187 (37%)
Nucleotidyl_cyc_III 812..999 CDD:299850 71/188 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.