DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and gcy-9

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:240 Identity:109/240 - (45%)
Similarity:157/240 - (65%) Gaps:11/240 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 QQKSKKLEESMR----LLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIV 428
            ::.:..||..:|    ||:|..::.|.||..|:||.:|:.|:.|:..:.  :::...::|||||.
 Worm   843 EEYTANLENMVRDRTALLEEAQKQADRLLNSMLPKSIAEDLKIGKPVLP--QLYSCATVLFSDIR 905

  Fly   429 TFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDAN-HAERVCDM 492
            .||.|.|..||::||:.||.|:|.||.:..::..|||||||||||:|:|.|.::.| ||:.:.|:
 Worm   906 GFTRISSTSTPLQVVTFLNDMFSGFDAIIAKHDAYKVETIGDAYMIVSGVPTENGNSHAQNIADV 970

  Fly   493 ALDMVDAITDLKDPSTGQHL-RIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMK 556
            ||.|...|.:.|.....:.| .:|:|.|||.|.||:|||..|||||||||||||||||||.:|.|
 Worm   971 ALKMRAFICNFKLAHRPEELMMVRIGFHSGPVAAGVVGLAAPRYCLFGDTVNTASRMESTGVANK 1035

  Fly   557 VHISESTKVLIG---PNYKIIERGEIDVKGKGTMGTYWLEERENR 598
            :.|||....|:.   |.::::|||:|:|||||...||:||.|..:
 Worm  1036 IQISEGAYNLLHCFFPQFQMVERGKIEVKGKGECLTYYLEGRTGK 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 13/39 (33%)
CYCc 383..571 CDD:214485 90/192 (47%)
Herpes_ICP4_C 794..>955 CDD:332854
gcy-9NP_509897.3 Periplasmic_Binding_Protein_Type_1 66..416 CDD:299141
ANF_receptor 69..404 CDD:279440
PKc_like 550..820 CDD:304357
HNOBA <837..883 CDD:285003 13/39 (33%)
CYCc 862..1054 CDD:214485 90/193 (47%)
Guanylate_cyc 889..1076 CDD:278633 92/188 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.