DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and gcy-1

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:638 Identity:182/638 - (28%)
Similarity:273/638 - (42%) Gaps:182/638 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EDIRRQAG--IDSPSF-SVHQVYPENLLQKLAKKAQQVLGVSERDF-MDQMGVYFVGFVGQYGYD 83
            |:|.|..|  |||..| ||.::.....||.:         :|..:| ||    ||..|.      
 Worm   617 ENINRFIGLSIDSAHFISVTKLCSRGSLQDI---------LSRGNFSMD----YFFMFC------ 662

  Fly    84 RVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQI 148
                    .:||...||:.||                     |..|.||             |.:
 Worm   663 --------IIRDVAKGLEYLH---------------------KTFLRLH-------------GNL 685

  Fly   149 REVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLA------SLAMTREEKHLPISAHV 207
            |. |....:....::|.  |...|.: |..|.....|...:|      ||::::.|.        
 Worm   686 RS-ATCLVNDSWQVKLA--EYGMDNL-VEEQTPPKKRLLWVAPEVLRGSLSVSQMEP-------- 738

  Fly   208 LFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELV 272
                       .||:.      |..:|..|:|.|| .||             .||:|..:..|:|
 Worm   739 -----------SADIY------SFAIIASEILTKK-EAW-------------DILDRKEDCEEIV 772

  Fly   273 ---------TVDP--VTERFDVQNEDLLQHED--GSEPEKSLRLKGQMVYMENWRMIMFLGTPVM 324
                     .:.|  :|:..||....:...:|  ...||.  |...:.:..:            |
 Worm   773 YNVKKGGLFPIRPEIITDIHDVNPALIALVKDCWAEVPED--RPTAENICSQ------------M 823

  Fly   325 PDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTD 389
            ..|.|...|.|..:..:|.:              |....|::|      :||..:.|..|.::.|
 Worm   824 KGLVSKQKTNLMDHVFNMLE--------------EYTSTLEEE------IEERTKELTLEKKKAD 868

  Fly   390 ELLYQMIPKQVADRLRRGE--NPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSI 452
            .||.:|:|||||:||:.|:  .|    |.||||::.|||:|.||.:.|:.:|.:.|::||.:||.
 Worm   869 ILLSRMLPKQVAERLKAGQTVEP----EGFDSVTVFFSDVVKFTILASKCSPFQTVNLLNDLYSN 929

  Fly   453 FDKLTERNSVYKVETIGDAYMVVAGAPDKDA-NHAERVCDMALDMVDAITDLKDPS-TGQHLRIR 515
            ||.:.|::.|||||:|||.|:.|:|.|.::. .|.:::.||:|..::.......|. ..:::.:|
 Worm   930 FDTIIEQHGVYKVESIGDGYLCVSGLPTRNGYAHIKQIVDMSLKFMEYCKSFNIPHLPRENVELR 994

  Fly   516 VGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIG---PN-YKIIER 576
            :||:||..|||:|||.|||||||||||||||||||......:|::.....|:.   || |:...|
 Worm   995 IGVNSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSLIHLTNDAHSLLTTHYPNQYETSSR 1059

  Fly   577 GEIDVKGKGTMGTYWLEERENRL-PLQLTAALQVHPLSPVPPT-----PTPKT 623
            ||:.:||||.|.|:|:..|...: |.:|.:   :...|..|.|     |.|.:
 Worm  1060 GEVIIKGKGVMETFWVHGRFGEMEPTELRS---ISNRSTPPVTNDRWIPNPSS 1109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572 32/144 (22%)
HNOBA 201..404 CDD:311573 45/215 (21%)
CYCc 383..571 CDD:214485 86/195 (44%)
Herpes_ICP4_C 794..>955 CDD:332854
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357 65/309 (21%)
HNOBA <840..883 CDD:285003 17/62 (27%)
CYCc 862..1051 CDD:214485 84/192 (44%)
Guanylate_cyc 889..1077 CDD:278633 84/191 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.