DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and acy-4

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:301 Identity:84/301 - (27%)
Similarity:158/301 - (52%) Gaps:33/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 MIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLA-------LDQEQQK-- 370
            |:|...|..   ||.|:.   :|..|..::...|::|......:.:.:.       .:..|:|  
 Worm   183 MLMIFSTFA---LTFLVA---FIGVLMDYNVGFDIILTRVMMVILVNVVGSLVYYPTEFVQRKTF 241

  Fly   371 --SKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF--------DSVSILFS 425
              ::|..:|..|||:||.|.:::|..::||.:|..:::.........||        :.:||||:
 Worm   242 HETRKCVQSRMLLDKEMHRQEKILLAVLPKNIAFEVKKDMQETHEERMFHKIYIRKYEDISILFA 306

  Fly   426 DIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVC 490
            ||..||.:.|...|.::|.|||.:::.|||:...:...:::.:||.|..|.|.|:...|||....
 Worm   307 DICGFTNLASEYNPKDLVLMLNELFARFDKVASIHQCMRIKILGDCYYCVCGVPEYQKNHAINTV 371

  Fly   491 DMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAM 555
            :|..||::||..::: .|..::.:|||:|:|....|::|||..::.::.:.|..|::|||..:|.
 Worm   372 EMGRDMIEAIRLVRE-MTLVNVNMRVGIHTGKAHCGVLGLKKWQFDVWSNDVTLANQMESGGLAG 435

  Fly   556 KVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERE 596
            :|||:::|:..:...| |:|      :|.|...:.:||:.:
 Worm   436 RVHITDATRSYLKGAY-ILE------EGNGGSRSKFLEKEK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 24/99 (24%)
CYCc 383..571 CDD:214485 60/195 (31%)
Herpes_ICP4_C 794..>955 CDD:332854
acy-4NP_504486.4 AC_N <50..291 CDD:292831 25/113 (22%)
CYCc 260..451 CDD:214485 58/191 (30%)
Guanylate_cyc 293..448 CDD:278633 51/155 (33%)
CYCc 778..984 CDD:214485
Guanylate_cyc 807..1003 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.