DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and Adcy6

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:287 Identity:84/287 - (29%)
Similarity:146/287 - (50%) Gaps:36/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 QEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF--------DSVSI 422
            |..|:::...::...|..|.|:.:.||..::|:.||..::...|......||        |:|||
Mouse   402 QAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSI 466

  Fly   423 LFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAE 487
            ||:||..||.:.|:.|..|:|..||.:::.||||...|...:::.:||.|..|:|.|:..|:||.
Mouse   467 LFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAH 531

  Fly   488 RVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTS 552
            ...:|.:||::||:.::: .||.::.:|||:|||.|..|::||:..::.::.:.|..|:.||:..
Mouse   532 CCVEMGVDMIEAISLVRE-VTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 595

  Fly   553 IAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWL------------------EERENRL 599
            .|.::||:.:|...:..:|::       ..|:|.....:|                  ||:....
Mouse   596 RAGRIHITRATLQYLNGDYEV-------EPGRGGERNAYLKEQCIETFLILGASQKRKEEKAMLA 653

  Fly   600 PLQLTAALQVHPLSP--VPPTPTPKTK 624
            .||.|.|..:..|.|  ||.....:||
Mouse   654 KLQRTRANSMEGLMPRWVPDRAFSRTK 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 10/37 (27%)
CYCc 383..571 CDD:214485 65/195 (33%)
Herpes_ICP4_C 794..>955 CDD:332854
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454 12/51 (24%)
Guanylate_cyc 456..640 CDD:306677 59/191 (31%)
DUF1053 668..754 CDD:368844 5/13 (38%)
Guanylate_cyc 1056..1250 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.