DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc88E and ADCY6

DIOPT Version :9

Sequence 1:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:287 Identity:84/287 - (29%)
Similarity:146/287 - (50%) Gaps:36/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 QEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF--------DSVSI 422
            |..|:::...::...|..|.|:.:.||..::|:.||..::...|......||        |:|||
Human   316 QAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSI 380

  Fly   423 LFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAE 487
            ||:||..||.:.|:.|..|:|..||.:::.||||...|...:::.:||.|..|:|.|:..|:||.
Human   381 LFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAH 445

  Fly   488 RVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTS 552
            ...:|.:||::||:.::: .||.::.:|||:|||.|..|::||:..::.::.:.|..|:.||:..
Human   446 CCVEMGVDMIEAISLVRE-VTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 509

  Fly   553 IAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWL------------------EERENRL 599
            .|.::||:.:|...:..:|::       ..|:|.....:|                  ||:....
Human   510 RAGRIHITRATLQYLNGDYEV-------EPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLA 567

  Fly   600 PLQLTAALQVHPLSP--VPPTPTPKTK 624
            .||.|.|..:..|.|  ||.....:||
Human   568 KLQRTRANSMEGLMPRWVPDRAFSRTK 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 10/37 (27%)
CYCc 383..571 CDD:214485 65/195 (33%)
Herpes_ICP4_C 794..>955 CDD:332854
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454 12/51 (24%)
Guanylate_cyc 370..554 CDD:306677 59/191 (31%)
DUF1053 582..668 CDD:399378 5/13 (38%)
Guanylate_cyc 970..1164 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.