DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and ALG1

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_009668.3 Gene:ALG1 / 852407 SGDID:S000000314 Length:449 Species:Saccharomyces cerevisiae


Alignment Length:50 Identity:14/50 - (28%)
Similarity:20/50 - (40%) Gaps:12/50 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWE 57
            |.|.:||..:|::          .|||.....:......||||  :..||
Yeast   402 RRELHESLIFAMK----------DADLYQKLKKNVTQEAENRW--QSNWE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 1/4 (25%)
ALG1NP_009668.3 GT33_ALG1-like 36..445 CDD:340843 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.