powered by:
Protein Alignment GlyS and ALG1
DIOPT Version :9
Sequence 1: | NP_731967.2 |
Gene: | GlyS / 41823 |
FlyBaseID: | FBgn0266064 |
Length: | 709 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009668.3 |
Gene: | ALG1 / 852407 |
SGDID: | S000000314 |
Length: | 449 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 50 |
Identity: | 14/50 - (28%) |
Similarity: | 20/50 - (40%) |
Gaps: | 12/50 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 RFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWE 57
|.|.:||..:|:: .|||.....:......|||| :..||
Yeast 402 RRELHESLIFAMK----------DADLYQKLKKNVTQEAENRW--QSNWE 439
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0438 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.