DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and Alg2

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_064382.3 Gene:Alg2 / 56737 MGIID:1914731 Length:415 Species:Mus musculus


Alignment Length:333 Identity:65/333 - (19%)
Similarity:108/333 - (32%) Gaps:134/333 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LLKRKPDII----TPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA 360
            |.:|:..::    .|:.|..::.||:.:|   :....:.|.|:..|.        .|:.|   :.
Mouse   126 LARRRKRVLFYCHFPDLLLTQRNSALKKF---YRAPIDWIEEYTTGM--------ADRIL---VN 176

  Fly   361 GRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTIN 425
            .:|.     |.:|.|....|:    |..||      :::|    :.|:.|               
Mouse   177 SQYT-----ASVFKETFKTLS----HRNPD------VLYP----SLNIGS--------------- 207

  Fly   426 NVQQAVGKRMFDTCLQGNIPNADDLLQKDDLV-KIKRCMF----AMQRDSMPPVTTHNV------ 479
                      ||..:...|         |||| |.|:.:|    ..:|....|:...::      
Mouse   208 ----------FDLAIPEKI---------DDLVPKGKQFLFLSINRYERKKNLPLALRSLVQLRNR 253

  Fly   480 --ADDWNDPVLSSIRRCHLF--NSRHDRV-----------KMV------FHPEFLTSTNPLFGID 523
              :.:|:        :.|||  ....||:           |||      .|..||.|.:....| 
Mouse   254 LPSQEWD--------KVHLFMAGGYDDRIPENVEHYKELKKMVQESDLERHVTFLRSFSDRQKI- 309

  Fly   524 YEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTN-----------LSGFGC---------F 568
              ..:.||...::....|.:|..|.|...|..|.:..|           ::||.|         .
Mouse   310 --SLLHGCLCVLYTPSNEHFGIVPLEAMYMQCPVIAVNNGGPLESIVHKVTGFLCEPDPVHFSEA 372

  Fly   569 MEEHISDP 576
            ||:.|..|
Mouse   373 MEKFIHKP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 65/333 (20%)
Alg2NP_064382.3 GT4_ALG2-like 17..407 CDD:340834 65/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.