DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and Alg1

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster


Alignment Length:132 Identity:27/132 - (20%)
Similarity:42/132 - (31%) Gaps:62/132 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 LVKIKRCMFAMQRDSMPP-------------VTTHNVADDWND----------------PVLSSI 491
            |:.|.|..|.:.::  ||             ||...:|.||::                |::..:
  Fly    93 LISIGRPSFLLVQN--PPGIPTLIVCYLYCAVTRTKLAIDWHNYTYTVLALGMSKGEQSPLIRLV 155

  Fly   492 RRC-HLFNSR---------------------------HDRVKMVFHPEFLTSTNPLF---GIDYE 525
            ||. ..|.|:                           :||....|||..||..:.|:   ..||.
  Fly   156 RRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQFHPIDLTHKHELYLKLAKDYP 220

  Fly   526 EF 527
            :|
  Fly   221 QF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 27/132 (20%)
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 27/132 (20%)
PLN02275 7..402 CDD:215155 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.