DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and alg2

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:XP_017206821.1 Gene:alg2 / 403068 ZFINID:ZDB-GENE-060502-2 Length:455 Species:Danio rerio


Alignment Length:263 Identity:55/263 - (20%)
Similarity:90/263 - (34%) Gaps:115/263 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 PVLSSIRRCHLFNSRHDR------------------VKMVF-HPEFLTSTNPLFGIDYEEFV--- 528
            ||..|.:.|.:|.|..::                  |::|| ||:        .||...|.:   
Zfish    19 PVSLSRQLCAIFVSHSNKQTDEFVSVNVKGSCQDSMVRVVFLHPD--------LGIGGAERLVVD 75

  Fly   529 -------RGCHLGVFPSYYEP-------------------W------GYTPAECTVMGIPSVTTN 561
                   |||.:.::.::|:|                   |      ||..|.|..:.:..:|  
Zfish    76 AAVALRSRGCSVQIWTAHYDPQHCFSETLSPDLPVVCVGDWLPTSVFGYFHALCAYLRMIYLT-- 138

  Fly   562 LSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSV---QQLSSFMMEFSRLNRRQRII-------Q 616
                               ||:|  .:.|.|..|   .|:|: .:.|.||.|:::.:       .
Zfish   139 -------------------IYLV--LFSGEEFDVVFCDQVSA-CIPFLRLARQRKKVLFYCHFPD 181

  Fly   617 RNRTERLSDL-------LDW---RTLGIYYR-----QARVKALQAVYPDYVDELS---LYGSKNN 663
            :..|:|.|.|       :||   .|.|:..|     |...|..:..:|. :.|:.   ||.|.|:
Zfish   182 QLLTQRRSALKRLYRGPIDWFEELTTGMADRILVNSQFTAKVFKQTFPK-LSEIHTDVLYPSLNS 245

  Fly   664 LIF 666
            ..|
Zfish   246 SAF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 55/263 (21%)
alg2XP_017206821.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.