DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and Alg2

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001094180.1 Gene:Alg2 / 313231 RGDID:1309940 Length:415 Species:Rattus norvegicus


Alignment Length:302 Identity:61/302 - (20%)
Similarity:103/302 - (34%) Gaps:91/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 PD-IITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNK 368
            || ::|....::|||         :....:.|.|:..|.        .|:.|   :..:|.    
  Rat   140 PDLLLTQRNSSLKKF---------YRAPIDWIEEYTTGM--------ADRIL---VNSQYT---- 180

  Fly   369 GADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGK 433
             |.:|.|....|:    |..||      :::|    :.|:.|. ..||.:::.|.:..     ||
  Rat   181 -ASVFKETFKTLS----HRNPD------VLYP----SLNIGSF-DLAVPEKIDDLVPK-----GK 224

  Fly   434 RMFDTCL-----QGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNV----ADDWNDPVLS 489
            :.....:     :.|:|     |....||::        |..:||.....|    |..::|.||.
  Rat   225 QFLFLSINRYERKKNLP-----LALSSLVQL--------RARLPPQEWEKVHLFMAGGYDDRVLE 276

  Fly   490 SIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMG 554
            ::..............:..|..||.|.:....|   ..:.||...::....|.:|..|.|...|.
  Rat   277 NVEHYKELKKIVQESDLERHVTFLRSFSDRQKI---SLLHGCLCVLYTPSNEHFGIVPLEAMYMQ 338

  Fly   555 IPSVTTN-----------LSGFGC---------FMEEHISDP 576
            .|.:..|           ::||.|         .||:.|..|
  Rat   339 CPVIAVNSGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 61/302 (20%)
Alg2NP_001094180.1 GT4_ALG2-like 17..407 CDD:340834 61/302 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.