DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and Piga

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_035211.2 Gene:Piga / 18700 MGIID:99461 Length:485 Species:Mus musculus


Alignment Length:407 Identity:82/407 - (20%)
Similarity:136/407 - (33%) Gaps:122/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LCAGNTDFYNNLDKFAVDEEAGKRQIYH-RYCL-ERGATHLAHVFTTVSEITGYEAEHLLKRKPD 306
            :|..:..||.|:.       ..:..||. ..|| |||     |...||:...|       .||..
Mouse    35 ICMVSDFFYPNMG-------GVESHIYQLSQCLIERG-----HKVITVTHAYG-------NRKGV 80

  Fly   307 IITPNGLNV------------------------------KKFSAIHEFQNLHAVAKEKI------ 335
            ....|||.|                              ::.:.||...:..|:|.:.:      
Mouse    81 RYLTNGLKVYYLPLRVMYNQSTATTLFHSLPLLRYIFVRERITIIHSHSSFSAMAHDALFHAKTM 145

  Fly   336 ---NEFVRGHFYGHIDFD---LDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHE-KPD-TT 392
               ..|.....:|..|..   .:|.|...:......      |.:...::.|.:|:.. .|: .:
Mouse   146 GLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNHI------ICVSYTSKENTVLRAALNPEIVS 204

  Fly   393 VVAFLIFPTKTNNFNVDSLRGH-AVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDL 456
            |:...:.||   :|..|..|.| :||     |:..|.:.|.::..| .|.|.||   :|.|    
Mouse   205 VIPNAVDPT---DFTPDPFRRHDSVI-----TVVVVSRLVYRKGTD-LLSGIIP---ELCQ---- 253

  Fly   457 VKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFG 521
             |.:...|.:..:....:            :|..:|..:   ..||||:::...|.....|.|  
Mouse   254 -KYQELHFLIGGEGPKRI------------ILEEVRERY---QLHDRVQLLGALEHKDVRNVL-- 300

  Fly   522 IDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH---ISDPKSYGIYI 583
                  |:| |:.:..|..|.:.....|....|:..|:|.:.|....:.|.   :.:|.      
Mouse   301 ------VQG-HIFLNTSLTEAFCMAIVEAASCGLQVVSTKVGGIPEVLPESLIILCEPS------ 352

  Fly   584 VDRRYIGLENSVQQLSS 600
            |.....|||.::.|:.|
Mouse   353 VKSLCDGLEKAIFQVKS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 82/407 (20%)
PigaNP_035211.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
GT4_PIG-A-like 34..433 CDD:340827 82/407 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.