DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyS and algn-1

DIOPT Version :9

Sequence 1:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_498420.2 Gene:algn-1 / 175920 WormBaseID:WBGene00020820 Length:491 Species:Caenorhabditis elegans


Alignment Length:148 Identity:39/148 - (26%)
Similarity:58/148 - (39%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 ITGYEAEHLLKRKPDIITPNG-LNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHI--DFDLDK 353
            :..|:....|.|...|||..| |..|....||| :||..|  :.:..::....|..|  ..||..
 Worm   290 LVAYDKTIGLPRVLMIITGKGPLKAKYLQEIHE-KNLKNV--DVLTPWLEAEDYPKILASADLGI 351

  Fly   354 TLYFFIAGRYEFGNKGADIF---IEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLR--G 413
            :|:...:| .:...|..|:|   :.|||     ||.:..|..|      ..|||.:..|...  .
 Worm   352 SLHTSTSG-LDLPMKVVDMFGAKVPALA-----LKFKCIDELV------EEKTNGYLFDDSEQLS 404

  Fly   414 HAVIKQLRDTINNVQQAV 431
            ..:|:..|...||..:.:
 Worm   405 RQIIELSRGFPNNCNELI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 39/148 (26%)
algn-1NP_498420.2 GT1_ALG1_like 11..447 CDD:99986 39/148 (26%)
PLN02275 12..410 CDD:215155 36/134 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.