DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3984 and Kprp

DIOPT Version :9

Sequence 1:NP_650420.1 Gene:CG3984 / 41821 FlyBaseID:FBgn0038291 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001002290.1 Gene:Kprp / 432393 RGDID:1303244 Length:699 Species:Rattus norvegicus


Alignment Length:371 Identity:91/371 - (24%)
Similarity:128/371 - (34%) Gaps:91/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PNPCQNGQVNAYIVCSPIILN--MYSNLC---GGQTGI--QCNPSNPVTTVVPGTPGCPN--TPQ 87
            |:.|.:|   :|..|:|...:  :|.:.|   |..:|.  :|.|.   ..:...:|.||.  .||
  Rat   325 PSRCSSG---SYNYCTPPRRSEPIYGSHCSPRGRPSGCSQRCGPK---CRIEISSPCCPRQVPPQ 383

  Fly    88 -YPTVVPNNPFNPNVNVVPGTP----GCPN--------------TPQYPTVVPNNTFN----PNV 129
             .|..:|  |........|..|    .||:              .||.....|.:::.    |..
  Rat   384 RCPVQIP--PIRGRSRSCPRQPSWGVSCPDLRPCAEPHAFPRPCRPQRLDRSPESSWRRCPVPAP 446

  Fly   130 NVVPATPGCPNTPQYPTVVPNNTFNPNVNVVPSTPGCPNTPQYPTVVPNNTFNPNVNVVPATPGC 194
            ...|....||:....|...|.          |....||:....|...|:...:|.:...|....|
  Rat   447 RPYPRPEPCPSPEPRPCPRPR----------PRPEPCPSPEPRPRPRPDPCPSPELRPRPRPEPC 501

  Fly   195 PNTPQYPTVVPDKPLCPN-----TPTTPACPNANGPSSC----NSNGPSSYPTNGP-SINAPSPT 249
            |:....|...||.  ||:     .|....||:.. |..|    ..:.|..||.  | |::.|.|.
  Rat   502 PSPEPRPRPRPDP--CPSPEPRPRPCPEPCPSPE-PRPCPPLRRFSEPCLYPE--PCSVSKPVPC 561

  Fly   250 SPPTTTP---------PSVTEQPAPAPPANPTPPPRPIPVPVTTPPP--DPIIRCP--------- 294
            ..|...|         |....||:|.....|.|.|.|.|||.::|.|  || |.||         
  Rat   562 PVPCPAPHPRPVHCETPGRRPQPSPRSQPCPHPEPMPRPVPCSSPVPCGDP-IHCPSPCSGHNPV 625

  Fly   295 ----EGTILVKGVCRLLFCGENSL-YIEGRCIQTRCPAGYVWTGIR 335
                |........|||...|.:|. :.:|:.....|.:|.|::|.|
  Rat   626 PYSQELGCHESNPCRLDTEGPSSYSFSQGQESNGCCVSGGVFSGSR 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3984NP_650420.1 PHA02030 <49..143 CDD:222843 25/125 (20%)
PHA02030 <109..199 CDD:222843 20/107 (19%)
KprpNP_001002290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..533 22/96 (23%)
Trypan_PARP <572..626 CDD:114603 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DMP2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.