DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3984 and F45B8.3

DIOPT Version :9

Sequence 1:NP_650420.1 Gene:CG3984 / 41821 FlyBaseID:FBgn0038291 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_510481.1 Gene:F45B8.3 / 181589 WormBaseID:WBGene00009720 Length:241 Species:Caenorhabditis elegans


Alignment Length:343 Identity:83/343 - (24%)
Similarity:102/343 - (29%) Gaps:156/343 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SPIILNMYSNLCG----GQTGIQCNPSNPVTTVVPGTPGCPNT-PQYPTVVPNNPFNPNVNV--- 103
            ||:: :.:...||    |::..|..||           .|.|. ||        ||||..|:   
 Worm    25 SPVV-HRFKRHCGYNGCGRSVCQECPS-----------CCGNDGPQ--------PFNPVFNIHFN 69

  Fly   104 -----VPGTPGCPNTPQYPTVVPNNTFNP--NVNVVPATPGCPNTPQYPTVVPNNTFNPNVNVVP 161
                 .|....||..|..|...|....:|  ..:.||| |.||..|                 .|
 Worm    70 CCGAPRPSPSCCPYVPPAPLPPPPPPASPCCGPSPVPA-PCCPPPP-----------------AP 116

  Fly   162 STPGCPNTPQYPTVVPNNTFNPNVNVVPATPG----CPNTPQYPTVVPDKPLC-------PNTPT 215
            :.|.||..|                  |.||.    |...|     ||:.|.|       |..|:
 Worm   117 AAPCCPPPP------------------PPTPSPLVCCKQAP-----VPENPCCQIVAAAMPPPPS 158

  Fly   216 TPACPNANGPSSCNSNGPSSYPTNGPSINAPSPTSPPTTTPPSVTEQPAPAPPANPTPPPRPIPV 280
            .|||        |              :.||.||:|..        ||||.|.......|||:|.
 Worm   159 APAC--------C--------------VAAPVPTNPCC--------QPAPRPAPCVCSAPRPVPC 193

  Fly   281 PVTTPPPDPIIRCPEGTILVKGVCRLLFCGENSLYIEGRCIQTRCPAGYVWTGIRCSKPQPLELG 345
            ....||    :.||.        |.:                   ||.      |||...|:|..
 Worm   194 RCGAPP----MECPN--------CDM-------------------PAP------RCSMMAPMECS 221

  Fly   346 NIHIENTVHQLPGALPHL 363
            ...:...|||  ..|.||
 Worm   222 MRRMRRDVHQ--QILQHL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3984NP_650420.1 PHA02030 <49..143 CDD:222843 28/108 (26%)
PHA02030 <109..199 CDD:222843 22/95 (23%)
F45B8.3NP_510481.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DMP2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.