DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6912 and CG15473

DIOPT Version :9

Sequence 1:NP_650419.1 Gene:CG6912 / 41820 FlyBaseID:FBgn0038290 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_572179.1 Gene:CG15473 / 31401 FlyBaseID:FBgn0029719 Length:714 Species:Drosophila melanogaster


Alignment Length:156 Identity:40/156 - (25%)
Similarity:58/156 - (37%) Gaps:52/156 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PLESTTTTT------TTTTTTTTEPTT---TTTTAEPTTTTTTTEP------------------- 126
            |..|||.:.      |||.|.:||.:|   .||.|...:|:|...|                   
  Fly   533 PELSTTVSAPSSNAGTTTETASTERSTHVIPTTIASFVSTSTHFSPLRSISRYRTTPKITAGRST 597

  Fly   127 -TTTTTTTEP-----------------------TTTTTTTEPTTTTTTTTTAPPVITELTRCPPG 167
             |||:|:|||                       ...:||:..:|||:||.|.|..|...|..|..
  Fly   598 TTTTSTSTEPPLNKWAKRRKEQDSKAKSSHRHEAFVSTTSSTSTTTSTTATPPSTIAASTGVPLA 662

  Fly   168 SIYFDSQCRKIVCSEGEYKAGRCISL 193
            |....:..:::|....:....|.:|:
  Fly   663 SPLPPAPSKEVVEVLTQKSVSRSVSI 688



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYII
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.