DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6966 and AT4G03440

DIOPT Version :9

Sequence 1:NP_001097796.1 Gene:CG6966 / 41816 FlyBaseID:FBgn0038286 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_192253.1 Gene:AT4G03440 / 827920 AraportID:AT4G03440 Length:751 Species:Arabidopsis thaliana


Alignment Length:477 Identity:95/477 - (19%)
Similarity:157/477 - (32%) Gaps:149/477 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AARDNNLAQLKA----------TLYNKSSVEVGSLISAKVNGATPLVISCRNGHYDIVE------ 58
            ||||.:|..:||          .|..:....:...|....||.|.|..:.::.|....|      
plant   166 AARDGHLTVVKALVASVTFCSDRLAEEDRERLNPYILKDKNGDTALHSALKDLHEKTKELHEKTK 230

  Fly    59 ------------------YLL--TKCRANVEQVGSVSFDGEPIEDAPPLWCAAAAGHLGIVK-ML 102
                              :|:  ..|..|..|  .|||.... ::..||:.|..||::.:|. ||
plant   231 DMHWLRRSKSKSLSNESTHLMETAACLVNANQ--DVSFLANK-DEISPLYLAVEAGNVSLVNAML 292

  Fly   103 VRRGANVNSTTRTNSTPLRAACFDGHYEIVKYLVHHGADFEVAN-------------------RH 148
            .....||...|...:|.|:..         |.|||  |..:..|                   ..
plant   293 NSHVNNVQDKTFNLATQLKGR---------KSLVH--AALKAKNTDVLDVILGKYPSLVKERDEK 346

  Fly   149 GHTCLMIACYKGHFR-IAQYLLSLNADVNRCSVKGNTALHDCAESGSLQILQLLLKH----GATM 208
            |.|||.:....|.:: |.:.|.:....:..|...|:..:|...|.|...:::.|||.    ...:
plant   347 GRTCLSVGASVGFYQGICKLLDTSTLSIFDCDDDGSFPIHKAVEKGHENVVKELLKRFPDSVEQL 411

  Fly   209 DVDYYGMTPLLAASVTGHMPIVEHLITLPCVSRESRIHALELLGATYVDRKRDM-------AAAL 266
            :.:...:..:.|.|....:.::||:..:     :::.|.:|         ::||       .|.:
plant   412 NKEGQNIFHISAKSGKSTLFLMEHINKV-----DTKNHLME---------EQDMDGNTPLHLATI 462

  Fly   267 NLWRRALEERAVEPPLEKKVQEPVPAYEMVREVTSVEELEEMVLDPDEMRMQALVIRQRILGPTH 331
            | ||.                      :.||.:|....:.:.:||    :..::.:|...:...:
plant   463 N-WRP----------------------KTVRMLTKFLSIRKKLLD----KHNSVGLRPLDIAEIN 500

  Fly   332 PDTSYYIRFRGAHYADAGRFDRCIELWSYALTMQQKILQPLSPMTQSS----------------- 379
            ..:.|..|         .|....:.|..|.|..:...|.|.|.||..|                 
plant   501 LQSDYVFR---------ERMTLMVLLGVYNLRQRGISLLPTSGMTLRSRSEKLGDGEKYKDRVNI 556

  Fly   380 LLSFAELFSFMLVEAGRLLPRG 401
            ||..|.|.:.|...||..:|.|
plant   557 LLLVAALVATMTFAAGFTMPGG 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6966NP_001097796.1 Ank_2 10..112 CDD:289560 32/138 (23%)
ANK 40..169 CDD:238125 38/175 (22%)
ANK repeat 40..72 CDD:293786 10/57 (18%)
ANK repeat 86..113 CDD:293786 10/27 (37%)
Ank_2 87..177 CDD:289560 25/110 (23%)
ANK 110..234 CDD:238125 28/147 (19%)
ANK repeat 118..146 CDD:293786 7/27 (26%)
ANK repeat 148..179 CDD:293786 7/31 (23%)
ANK repeat 181..210 CDD:293786 7/32 (22%)
Ank_4 182..234 CDD:290365 11/55 (20%)
ANK 528..>612 CDD:238125
ANK repeat 529..573 CDD:293786
ANK repeat 575..607 CDD:293786
AT4G03440NP_192253.1 ANK 121..292 CDD:238125 28/128 (22%)
Ank_4 125..179 CDD:290365 7/12 (58%)
ANK repeat 125..155 CDD:293786
ANK repeat 157..204 CDD:293786 9/37 (24%)
Ank_2 163..301 CDD:289560 32/137 (23%)
ANK 269..401 CDD:238125 31/143 (22%)
ANK repeat 274..301 CDD:293786 10/26 (38%)
Ank_2 276..406 CDD:289560 33/140 (24%)
ANK 342..472 CDD:238125 29/166 (17%)
ANK repeat 347..378 CDD:293786 7/30 (23%)
ANK repeat 380..412 CDD:293786 7/31 (23%)
Ank_5 400..460 CDD:290568 11/73 (15%)
ANK repeat 414..450 CDD:293786 6/49 (12%)
PGG 548..655 CDD:290670 9/31 (29%)
PotE <557..714 CDD:223605 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.