DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6966 and AT4G03450

DIOPT Version :9

Sequence 1:NP_001097796.1 Gene:CG6966 / 41816 FlyBaseID:FBgn0038286 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_192254.1 Gene:AT4G03450 / 827913 AraportID:AT4G03450 Length:641 Species:Arabidopsis thaliana


Alignment Length:415 Identity:86/415 - (20%)
Similarity:127/415 - (30%) Gaps:182/415 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFNAARDNNLAQLKATLYNKSSVEVGSLISAKVNGATPLVISC-RN-------------GHYDIV 57
            :|:|.|..|               |..|...|.|..|||  :| ||             |..::|
plant    40 IFSAMRAGN---------------VKFLDKMKTNNNTPL--ACFRNETGDFTLHLAAAWGRLELV 87

  Fly    58 EYLLTKCRANVEQVGSVSFDGEPIEDAPPLWCAAAAGHLGIVKMLVRR------GANVNSTTRTN 116
            :.::::|...:.:..|        :|..||..|||||.|.:|:..|.|      |.:.....|.|
plant    88 KRIVSECPCLLLETNS--------KDQIPLHAAAAAGRLAVVEAFVARVNEISDGLSEEERERVN 144

  Fly   117 ---------STPLRAACFDGHYEIVKYLV--HHGADFEVANRH---------------------- 148
                     :|.|..|...||.:....||  :|.|.| :||.|                      
plant   145 LYAMKDIDGNTALHLALKGGHLKTAACLVKANHLASF-LANNHGVSPLFTAIIAGSLTLVEAMMY 208

  Fly   149 ------------------------------------------------GHTCLMIACYKGHFR-I 164
                                                            |.|||.:|.|.|::: :
plant   209 VPGQTCNLASKLEGRKSLVHAALKAKNSDILDVILSEDPSLVNERDEEGRTCLSVAAYVGYYKGV 273

  Fly   165 AQYLLSLNADVNRC----------------------------------SVKGNTALHDCAESGS- 194
            ...|....::|..|                                  :.:|...||..|:||. 
plant   274 VNLLHRSTSNVFECDDDGSYPIHMAVEKGRVKIFLKLLKCCPDSQYLLNKQGQNILHIAAKSGKT 338

  Fly   195 ----LQILQL--LLKHGATMDVDYYGMTPLLAASVTGHMPIVEHLITLPCVSRESRIHALELLGA 253
                ||:::.  |:|:...|:.|..|.|||             ||.||....|...|.....||.
plant   339 GTYLLQVIKAYDLIKNDLIMEQDVDGNTPL-------------HLATLTWRPRTVNILNKFTLGN 390

  Fly   254 TYVDRKRDMAAALNLWRRALEERAV 278
            ....|.:|..:||::....|:...|
plant   391 HLHIRNKDGLSALDIAESNLQSNYV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6966NP_001097796.1 Ank_2 10..112 CDD:289560 30/121 (25%)
ANK 40..169 CDD:238125 46/230 (20%)
ANK repeat 40..72 CDD:293786 10/45 (22%)
ANK repeat 86..113 CDD:293786 12/32 (38%)
Ank_2 87..177 CDD:289560 35/177 (20%)
ANK 110..234 CDD:238125 42/246 (17%)
ANK repeat 118..146 CDD:293786 10/29 (34%)
ANK repeat 148..179 CDD:293786 11/135 (8%)
ANK repeat 181..210 CDD:293786 11/35 (31%)
Ank_4 182..234 CDD:290365 17/58 (29%)
ANK 528..>612 CDD:238125
ANK repeat 529..573 CDD:293786
ANK repeat 575..607 CDD:293786
AT4G03450NP_192254.1 ANK 67..207 CDD:238125 34/148 (23%)
Ank_2 75..176 CDD:289560 26/108 (24%)
ANK repeat 75..102 CDD:293786 3/26 (12%)
ANK repeat 104..150 CDD:293786 15/45 (33%)
ANK 148..311 CDD:238125 23/163 (14%)
Ank_2 <149..207 CDD:289560 13/58 (22%)
ANK repeat 152..184 CDD:293786 10/32 (31%)
Ank_2 228..316 CDD:289560 10/87 (11%)
ANK 251..383 CDD:238125 31/144 (22%)
ANK repeat 256..288 CDD:293786 9/31 (29%)
Ank_2 295..383 CDD:289560 21/100 (21%)
ANK repeat 324..361 CDD:293786 11/36 (31%)
PGG 455..564 CDD:290670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.