DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6966 and AT4G03480

DIOPT Version :9

Sequence 1:NP_001097796.1 Gene:CG6966 / 41816 FlyBaseID:FBgn0038286 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_192257.5 Gene:AT4G03480 / 827906 AraportID:AT4G03480 Length:659 Species:Arabidopsis thaliana


Alignment Length:486 Identity:98/486 - (20%)
Similarity:173/486 - (35%) Gaps:145/486 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YKFIVFNAARDNNLAQLKA----TLYNKSSV------EVGSLISAKVNGATPLVISCRNGHYDI- 56
            |:..:..|||....|.:||    .||....|      .:...:...::|.|||..:.::.|... 
plant   191 YQIPLHVAARAGRSAVVKALVASVLYFSPRVPEEDRDRLNIYVLKDIDGDTPLHAALKDLHEKAE 255

  Fly    57 VEYLL------------------------------------TKCRANVEQVGS--VSFDGEPIED 83
            |.:||                                    ..|..|.:|..|  .:.||     
plant   256 VSHLLRYQERIRKLSLSHLIMHWRRSRCISFSDASTRQMETAACLVNADQHASFLANKDG----- 315

  Fly    84 APPLWCAAAAGHLGIVK-MLVRRGANVNSTTRT-------NSTPLRAACFDGHYEIVKYLVHHGA 140
            ..||:.|..||::.:|: ||.|.|..:...|.|       ..:.|.||....:.:::..:::.  
plant   316 TSPLYLAVEAGNVSLVRAMLNRPGNKIQGKTSTLASQLEGRKSLLHAALKAKNTDVLNVILND-- 378

  Fly   141 DFEVAN---RHGHTCLMIACYKGHFR-IAQYLLSLNADVNRCSVKGNTALHDCAESGSLQILQLL 201
            |..:.|   ..|.|||.:....|::: |.:.|......|..|...|:..:|...|.|.|::::.:
plant   379 DPSLVNERDEEGRTCLSVGASMGYYKGICKLLDRSTKSVYECDKDGSFPIHMAVEKGHLKVVKEI 443

  Fly   202 LKH--GATMDVDYYGMTPLLAAS--------VTGHMPIVE---HLITLPCVSRESRIHALELLGA 253
            ||.  .:...|:..|...|..|:        :.|::..::   |||....|...:.:|       
plant   444 LKRCPDSKELVNKQGQNMLHIAAKSAKVGSFLLGYIRRLDTENHLIEEQDVDGNAPLH------- 501

  Fly   254 TYVDRKRDMAAALNLWR-RALEERAVEPPLEKKVQEPVPAYEMVREVTSVEELEEMVLDPDEMRM 317
                     .|.:| || |.:::.|.....|.|:.. :...:.:|.:    ::.|:.|.||    
plant   502 ---------LATIN-WRCRTVDKLAAFASTETKILN-IQNKDGLRPL----DIAELNLQPD---- 547

  Fly   318 QALVIRQR--------ILGPTH----PDTSYYIRFRGAHYADAGRFDRCIELWSYALTMQQKILQ 370
              .|:|:|        :..|..    |.:...:|.| :...||.::...|               
plant   548 --YVLRERLTLMVLLCVYAPKSVGWLPTSGMTLRSR-SEPLDAKKYKDHI--------------- 594

  Fly   371 PLSPMTQSSLLSFAELFSFMLVEAGRLLPRG 401
                   ::||..|.|.:.:...||..:|.|
plant   595 -------NALLLVATLVATVTFAAGFTIPGG 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6966NP_001097796.1 Ank_2 10..112 CDD:289560 33/151 (22%)
ANK 40..169 CDD:238125 37/179 (21%)
ANK repeat 40..72 CDD:293786 11/68 (16%)
ANK repeat 86..113 CDD:293786 10/27 (37%)
Ank_2 87..177 CDD:289560 24/101 (24%)
ANK 110..234 CDD:238125 29/147 (20%)
ANK repeat 118..146 CDD:293786 4/27 (15%)
ANK repeat 148..179 CDD:293786 8/31 (26%)
ANK repeat 181..210 CDD:293786 7/30 (23%)
Ank_4 182..234 CDD:290365 13/64 (20%)
ANK 528..>612 CDD:238125
ANK repeat 529..573 CDD:293786
ANK repeat 575..607 CDD:293786
AT4G03480NP_192257.5 ANK 157..335 CDD:238125 30/148 (20%)
Ank_4 157..211 CDD:290365 7/19 (37%)
ANK repeat 190..236 CDD:293786 10/44 (23%)
Ank_2 <310..387 CDD:289560 19/83 (23%)
ANK 312..444 CDD:238125 33/138 (24%)
ANK repeat 314..344 CDD:293786 12/34 (35%)
ANK repeat 358..387 CDD:293786 5/30 (17%)
Ank_2 360..449 CDD:289560 21/90 (23%)
ANK 384..515 CDD:238125 32/147 (22%)
ANK repeat 389..421 CDD:293786 8/31 (26%)
ANK repeat 423..448 CDD:293786 7/24 (29%)
Ank_2 428..515 CDD:289560 21/103 (20%)
PGG 588..>659 CDD:290670 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.