DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6966 and AT4G14390

DIOPT Version :9

Sequence 1:NP_001097796.1 Gene:CG6966 / 41816 FlyBaseID:FBgn0038286 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_193175.2 Gene:AT4G14390 / 827084 AraportID:AT4G14390 Length:694 Species:Arabidopsis thaliana


Alignment Length:218 Identity:53/218 - (24%)
Similarity:90/218 - (41%) Gaps:32/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NGATPLVISCRNGHYDIVEYLLTKCRANVEQVGSVSFDGEPIEDAPPLWCAAAAGHLGIVKMLVR 104
            :|.|||     .|..:.|...||..|.:    ...:..||.:...|.::...:.|:...::.|..
plant    64 DGVTPL-----TGDTESVPEFLTNLRLS----DLYAIRGEDVRMIPEVFSKISDGNKECLEKLRS 119

  Fly   105 RGANV-NSTTRTNSTPLRAACFDGHYEIVKYLVHHGADFEV-ANRHGHTCLMIACYKGHFRIAQY 167
            ||.:| ...:.|..:.|..|...||.|:||.:|.......: .|..|.|.|.:|.:.||..|.:.
plant   120 RGISVARIKSNTGDSILHLAVTWGHLELVKEIVCECPRLLLEQNSSGQTPLHVAAHSGHTTIVEA 184

  Fly   168 LLSL---------NADVNRCS------VKGNTALHDCAESGSLQILQLLLKHGATMDVDY----Y 213
            .::|         |.:..|.:      ..|||||:...|....::...|:  .|..|..:    |
plant   185 FVALVTFSSARLCNEESERMNPYVLKDKDGNTALYYAIEGRYFEMAVCLV--NANQDAPFLGNKY 247

  Fly   214 GMTPLLAASVTGHMPIVEHLITL 236
            |::.|..|..||.:.:|:.::.:
plant   248 GVSSLFVAINTGDVSLVKAILKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6966NP_001097796.1 Ank_2 10..112 CDD:289560 17/72 (24%)
ANK 40..169 CDD:238125 34/130 (26%)
ANK repeat 40..72 CDD:293786 9/31 (29%)
ANK repeat 86..113 CDD:293786 5/27 (19%)
Ank_2 87..177 CDD:289560 24/100 (24%)
ANK 110..234 CDD:238125 36/143 (25%)
ANK repeat 118..146 CDD:293786 8/28 (29%)
ANK repeat 148..179 CDD:293786 10/39 (26%)
ANK repeat 181..210 CDD:293786 8/28 (29%)
Ank_4 182..234 CDD:290365 16/55 (29%)
ANK 528..>612 CDD:238125
ANK repeat 529..573 CDD:293786
ANK repeat 575..607 CDD:293786
AT4G14390NP_193175.2 ANK 127..268 CDD:238125 36/142 (25%)
Ank_2 136..239 CDD:289560 27/104 (26%)
ANK repeat 165..211 CDD:293786 10/45 (22%)
ANK repeat 213..238 CDD:293786 8/26 (31%)
ANKYR 291..505 CDD:223738
ANK 319..448 CDD:238125
ANK repeat 324..356 CDD:293786
ANK repeat 358..390 CDD:293786
ANK repeat 392..426 CDD:293786
PGG 513..620 CDD:290670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.