| Sequence 1: | NP_001097796.1 | Gene: | CG6966 / 41816 | FlyBaseID: | FBgn0038286 | Length: | 664 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_567428.1 | Gene: | XBAT34 / 827080 | AraportID: | AT4G14365 | Length: | 376 | Species: | Arabidopsis thaliana |
| Alignment Length: | 223 | Identity: | 58/223 - (26%) |
|---|---|---|---|
| Similarity: | 92/223 - (41%) | Gaps: | 40/223 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 126 DGHYEIVKYLVHHGADFEVANRHGHTCLMIACYKGH-FRIAQYLLSLNADVN--RCSVKGNTALH 187
Fly 188 DCAESGSLQILQLLLKHGA---TMDVDYYGMTPLLAASVTGHMPIV----EHLITLP-CVSRESR 244
Fly 245 IHALELLGATYVDRKRDMAAALNLW--------RRALEERAVEPPLEKKVQEPVPAYEMVREVTS 301
Fly 302 VEELEE-------MVLD----PDEMRMQ 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6966 | NP_001097796.1 | Ank_2 | 10..112 | CDD:289560 | |
| ANK | 40..169 | CDD:238125 | 13/43 (30%) | ||
| ANK repeat | 40..72 | CDD:293786 | |||
| ANK repeat | 86..113 | CDD:293786 | |||
| Ank_2 | 87..177 | CDD:289560 | 18/53 (34%) | ||
| ANK | 110..234 | CDD:238125 | 39/117 (33%) | ||
| ANK repeat | 118..146 | CDD:293786 | 7/19 (37%) | ||
| ANK repeat | 148..179 | CDD:293786 | 12/33 (36%) | ||
| ANK repeat | 181..210 | CDD:293786 | 12/31 (39%) | ||
| Ank_4 | 182..234 | CDD:290365 | 20/58 (34%) | ||
| ANK | 528..>612 | CDD:238125 | |||
| ANK repeat | 529..573 | CDD:293786 | |||
| ANK repeat | 575..607 | CDD:293786 | |||
| XBAT34 | NP_567428.1 | Ank_2 | 13..108 | CDD:289560 | 31/88 (35%) |
| ANK | 17..130 | CDD:238125 | 38/112 (34%) | ||
| ANK repeat | 41..73 | CDD:293786 | 11/31 (35%) | ||
| ANK repeat | 77..108 | CDD:293786 | 12/30 (40%) | ||
| Ank_2 | 82..>150 | CDD:289560 | 20/69 (29%) | ||
| zf-C3HC4_3 | 321..370 | CDD:290631 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||