Sequence 1: | NP_001097796.1 | Gene: | CG6966 / 41816 | FlyBaseID: | FBgn0038286 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991159.1 | Gene: | ankrd46b / 402888 | ZFINID: | ZDB-GENE-050114-7 | Length: | 228 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 52/206 - (25%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 44/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 VNSTTRTNSTPLRAACFDGHYEIVKYLVHHGADFEVANRHGHTCLMIACYKGHFRIAQYLLSLNA 173
Fly 174 DVNRCSVKGNTALHDCAESGSLQILQLLLKHGATMDV-DYYGMTPLLAASVTGHMPIVEHLITLP 237
Fly 238 CVSRESRIHALELLGATYVDRKRDMAAALNLWRRALEERAVEPPLEKKVQEPVPAYEMVREVTSV 302
Fly 303 EELEEMVLDPD 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6966 | NP_001097796.1 | Ank_2 | 10..112 | CDD:289560 | 1/2 (50%) |
ANK | 40..169 | CDD:238125 | 18/59 (31%) | ||
ANK repeat | 40..72 | CDD:293786 | |||
ANK repeat | 86..113 | CDD:293786 | 1/3 (33%) | ||
Ank_2 | 87..177 | CDD:289560 | 21/67 (31%) | ||
ANK | 110..234 | CDD:238125 | 39/124 (31%) | ||
ANK repeat | 118..146 | CDD:293786 | 9/27 (33%) | ||
ANK repeat | 148..179 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 181..210 | CDD:293786 | 11/28 (39%) | ||
Ank_4 | 182..234 | CDD:290365 | 18/52 (35%) | ||
ANK | 528..>612 | CDD:238125 | |||
ANK repeat | 529..573 | CDD:293786 | |||
ANK repeat | 575..607 | CDD:293786 | |||
ankrd46b | NP_991159.1 | ANK 1 | 11..40 | 11/29 (38%) | |
ANK | 15..128 | CDD:238125 | 38/132 (29%) | ||
ANK repeat | 15..42 | CDD:293786 | 9/26 (35%) | ||
Ank_2 | 16..105 | CDD:289560 | 29/91 (32%) | ||
ANK repeat | 44..75 | CDD:293786 | 9/30 (30%) | ||
ANK 2 | 44..73 | 9/28 (32%) | |||
ANK repeat | 77..105 | CDD:293786 | 12/30 (40%) | ||
ANK 3 | 77..103 | 11/28 (39%) | |||
ANK 4 | 107..138 | 14/67 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0508 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |