DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6966 and ANKRD46

DIOPT Version :9

Sequence 1:NP_001097796.1 Gene:CG6966 / 41816 FlyBaseID:FBgn0038286 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001257308.1 Gene:ANKRD46 / 157567 HGNCID:27229 Length:232 Species:Homo sapiens


Alignment Length:188 Identity:51/188 - (27%)
Similarity:83/188 - (44%) Gaps:25/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VNSTTRTNSTPLRAACFDGHYEIVKYLVHHGADFEVANRHGHTCLMIACYKGHFRIAQYLLSLNA 173
            ||.:::|| .||..||.||.:...|.|:..|.|..:.:..|.|.|.:|..:|:..|.|.|....|
Human     6 VNDSSQTN-VPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGA 69

  Fly   174 DVNRCSVKGNTALHDCAESGSLQILQLLLKHGATMDV-DYYGMTPLLAASVTGHMPIVEHLI--- 234
            |:.....:||||||.|   |.:..:|.|:.:|..:|: ::.|.|||:.|...|....|..|:   
Human    70 DLLATDYQGNTALHLC---GHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESL 131

  Fly   235 -----------------TLPCVSRESRIHALELLGATYVDRKRDMAAALNLWRRALEE 275
                             |:.....||.:.:..||.......:..:::....|:..:|:
Human   132 EEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6966NP_001097796.1 Ank_2 10..112 CDD:289560 2/2 (100%)
ANK 40..169 CDD:238125 21/59 (36%)
ANK repeat 40..72 CDD:293786
ANK repeat 86..113 CDD:293786 2/3 (67%)
Ank_2 87..177 CDD:289560 24/67 (36%)
ANK 110..234 CDD:238125 42/124 (34%)
ANK repeat 118..146 CDD:293786 10/27 (37%)
ANK repeat 148..179 CDD:293786 10/30 (33%)
ANK repeat 181..210 CDD:293786 11/28 (39%)
Ank_4 182..234 CDD:290365 19/52 (37%)
ANK 528..>612 CDD:238125
ANK repeat 529..573 CDD:293786
ANK repeat 575..607 CDD:293786
ANKRD46NP_001257308.1 ANK 1 11..40 12/29 (41%)
ANK 15..128 CDD:238125 39/115 (34%)
ANK repeat 15..42 CDD:293786 10/26 (38%)
ANK repeat 44..75 CDD:293786 10/30 (33%)
ANK 2 44..73 10/28 (36%)
ANK repeat 77..105 CDD:293786 12/30 (40%)
ANK 3 77..103 11/28 (39%)
ANK 4 107..138 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.