Sequence 1: | NP_001097796.1 | Gene: | CG6966 / 41816 | FlyBaseID: | FBgn0038286 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334017.1 | Gene: | LOC110440003 / 110440003 | -ID: | - | Length: | 289 | Species: | Danio rerio |
Alignment Length: | 262 | Identity: | 133/262 - (50%) |
---|---|---|---|
Similarity: | 162/262 - (61%) | Gaps: | 23/262 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDYKFIVFNAARDNNLAQLKATLYNKSSVEVGSLISAKVNGATPLVISCRNGHYDIVEYLLTKCR 65
Fly 66 ANVEQVGSVSFDGEPIEDAPPLWCAAAAGHLGIVKMLVRRGANVNSTTRTNSTPLRAACFDGHYE 130
Fly 131 IVKYLVHHGADFEVANRHGHTCLMIACYKGHFRIAQYLLSLNADVNRCSVKGNTAL-----HDCA 190
Fly 191 ESGSLQILQLLLKHGATMDVDYYGMTPLLA--ASVTGH--MPIVEHLITLPCVSRESRIHALELL 251
Fly 252 GA 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6966 | NP_001097796.1 | Ank_2 | 10..112 | CDD:289560 | 54/101 (53%) |
ANK | 40..169 | CDD:238125 | 89/128 (70%) | ||
ANK repeat | 40..72 | CDD:293786 | 16/31 (52%) | ||
ANK repeat | 86..113 | CDD:293786 | 16/26 (62%) | ||
Ank_2 | 87..177 | CDD:289560 | 66/89 (74%) | ||
ANK | 110..234 | CDD:238125 | 70/132 (53%) | ||
ANK repeat | 118..146 | CDD:293786 | 22/27 (81%) | ||
ANK repeat | 148..179 | CDD:293786 | 23/30 (77%) | ||
ANK repeat | 181..210 | CDD:293786 | 7/33 (21%) | ||
Ank_4 | 182..234 | CDD:290365 | 13/60 (22%) | ||
ANK | 528..>612 | CDD:238125 | |||
ANK repeat | 529..573 | CDD:293786 | |||
ANK repeat | 575..607 | CDD:293786 | |||
LOC110440003 | XP_021334017.1 | Ank_2 | <6..68 | CDD:330894 | 27/61 (44%) |
ANK | 40..169 | CDD:238125 | 89/128 (70%) | ||
ANK repeat | 40..75 | CDD:293786 | 18/34 (53%) | ||
ANK repeat | 82..113 | CDD:293786 | 19/30 (63%) | ||
ANK repeat | 115..146 | CDD:293786 | 25/30 (83%) | ||
ANK repeat | 148..178 | CDD:293786 | 22/29 (76%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D133963at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |