DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6966 and LOC110440003

DIOPT Version :9

Sequence 1:NP_001097796.1 Gene:CG6966 / 41816 FlyBaseID:FBgn0038286 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_021334017.1 Gene:LOC110440003 / 110440003 -ID:- Length:289 Species:Danio rerio


Alignment Length:262 Identity:133/262 - (50%)
Similarity:162/262 - (61%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYKFIVFNAARDNNLAQLKATLYNKSSVEVGSLISAKVNGATPLVISCRNGHYDIVEYLLTKCR 65
            ||....|||||||..|..::..|.|||..|..:|...:..|.|||:|:.|.||..:|.:||.:|.
Zfish     1 MDISAAVFNAARDGKLKLMQKLLINKSPEERAALAEERTEGGTPLLIAARYGHLPVVHFLLERCG 65

  Fly    66 ANVEQVGSVSFDGEPIEDAPPLWCAAAAGHLGIVKMLVRRGANVNSTTRTNSTPLRAACFDGHYE 130
            ||||..|||:||||.||.|||||.|:|||||.:||.|:..||:||:||.||||||||||||||.|
Zfish    66 ANVELGGSVNFDGETIEGAPPLWAASAAGHLPVVKALLEHGASVNNTTLTNSTPLRAACFDGHLE 130

  Fly   131 IVKYLVHHGADFEVANRHGHTCLMIACYKGHFRIAQYLLSLNADVNRCSVKGNTAL-----HDCA 190
            ||:|||.|.||.|||||||||||||:|||||..|||:||...|||||.||||...|     :.| 
Zfish   131 IVRYLVEHQADLEVANRHGHTCLMISCYKGHREIAQFLLEKGADVNRRSVKGGVLLLSLIIYTC- 194

  Fly   191 ESGSLQILQLLLKHGATMDVDYYGMTPLLA--ASVTGH--MPIVEHLITLPCVSRESRIHALELL 251
                    :|:..|..|     :..||..:  ||.:.|  :.|..||.|..|....:.:|..:.:
Zfish   195 --------KLITAHLQT-----HHCTPASSSPASTSLHTCILITAHLQTHHCTPASTSLHTCKHI 246

  Fly   252 GA 253
            .|
Zfish   247 TA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6966NP_001097796.1 Ank_2 10..112 CDD:289560 54/101 (53%)
ANK 40..169 CDD:238125 89/128 (70%)
ANK repeat 40..72 CDD:293786 16/31 (52%)
ANK repeat 86..113 CDD:293786 16/26 (62%)
Ank_2 87..177 CDD:289560 66/89 (74%)
ANK 110..234 CDD:238125 70/132 (53%)
ANK repeat 118..146 CDD:293786 22/27 (81%)
ANK repeat 148..179 CDD:293786 23/30 (77%)
ANK repeat 181..210 CDD:293786 7/33 (21%)
Ank_4 182..234 CDD:290365 13/60 (22%)
ANK 528..>612 CDD:238125
ANK repeat 529..573 CDD:293786
ANK repeat 575..607 CDD:293786
LOC110440003XP_021334017.1 Ank_2 <6..68 CDD:330894 27/61 (44%)
ANK 40..169 CDD:238125 89/128 (70%)
ANK repeat 40..75 CDD:293786 18/34 (53%)
ANK repeat 82..113 CDD:293786 19/30 (63%)
ANK repeat 115..146 CDD:293786 25/30 (83%)
ANK repeat 148..178 CDD:293786 22/29 (76%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133963at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.